Protein Info for PS417_01900 in Pseudomonas simiae WCS417

Annotation: poly(3-hydroxyalkanoate) depolymerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 281 transmembrane" amino acids 190 to 206 (17 residues), see Phobius details TIGR02240: poly(3-hydroxyalkanoate) depolymerase" amino acids 4 to 279 (276 residues), 604.4 bits, see alignment E=1.3e-186 PF00561: Abhydrolase_1" amino acids 30 to 254 (225 residues), 141.6 bits, see alignment E=5.4e-45 PF12146: Hydrolase_4" amino acids 31 to 245 (215 residues), 40.6 bits, see alignment E=2.9e-14 PF12697: Abhydrolase_6" amino acids 34 to 259 (226 residues), 59.9 bits, see alignment E=9.1e-20

Best Hits

Swiss-Prot: 89% identical to PHAZ_PSEOL: Poly(3-hydroxyalkanoate) depolymerase (phaZ) from Pseudomonas oleovorans

KEGG orthology group: None (inferred from 98% identity to pfs:PFLU0395)

MetaCyc: 89% identical to intracellular poly(3-hydroxyoctanoate) depolymerase (Pseudomonas putida KT2442)
Poly(3-hydroxyoctanoate) depolymerase. [EC: 3.1.1.76]

Predicted SEED Role

"Poly(3-hydroxyalkanoate) depolymerase" in subsystem Polyhydroxybutyrate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.1.76

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U138 at UniProt or InterPro

Protein Sequence (281 amino acids)

>PS417_01900 poly(3-hydroxyalkanoate) depolymerase (Pseudomonas simiae WCS417)
MPQPFIFRTIDLDGQALRTAVRPGKPHLTPLLIFNGIGANLELVFPFVQALDPDLEVIAF
DVPGVGGSSTPKRPYRFPGLAKLTARMLDYLDYGQVNAVGVSWGGALAQQFAYDYPERCK
KLILAATAAGAFMVPGKPKVLWLMASPRRYIQPSHVVRIAPMIYGGSFRRDSNLAAEHAS
KVRSAGKLGYYWQLFAGLGWTSIHWLHKIRQPTLVLAGDDDPLIPLINMRMLAWRIPNAQ
LHIIDDGHLFLITRAEAVAPIIMKFLEEERMRAVIHPRPAV