Protein Info for PS417_19075 in Pseudomonas simiae WCS417

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 443 PF00005: ABC_tran" amino acids 42 to 175 (134 residues), 88 bits, see alignment E=9.3e-29 PF14524: Wzt_C" amino acids 295 to 432 (138 residues), 84.6 bits, see alignment E=6.7e-28

Best Hits

KEGG orthology group: K09691, lipopolysaccharide transport system ATP-binding protein (inferred from 54% identity to dae:Dtox_4136)

Predicted SEED Role

"Teichoic acid export ATP-binding protein TagH (EC 3.6.3.40)" in subsystem Rhamnose containing glycans or Teichoic and lipoteichoic acids biosynthesis (EC 3.6.3.40)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.40

Use Curated BLAST to search for 3.6.3.40

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U6G6 at UniProt or InterPro

Protein Sequence (443 amino acids)

>PS417_19075 ABC transporter ATP-binding protein (Pseudomonas simiae WCS417)
MPSEIAIQVRNVSKRFQIYDSPRARLLQVFRKKRCYTEFVALDDVSFVVNKGETVGIVGR
NGSGKSTLLQMICGTLTPTEGEVSTHGRIAALLELGSGFNPEFSGRENVYMNASVLGLSH
AETSARFASIEAFAEIGDFIDRPVKSYSSGMMVRLAFAVAINVDPQILIVDEALAVGDEL
FQRKCFARIESIKSQGATILFVSHASDTVVALCDRAILLDGGQKVAEGTPKAIVGKYQRM
LNASPAKAKEMREQMMAGSVEFTSVAEVDAPALDANSGLASDYFDPHLLSKAVLSYEARG
AVIANPGLLNARRQKVNCLKAGETYLYTYQVAFEQDASHVRFGMLIKTTTGVELGGGTSA
KRITEGIEFVAAGSVLTVEYSFVCRLNEGLYFLNAGVSGDCGEGFRHLHRVVDALCFRVN
SEHTQYGVGVVDFSCAPEWSLAR