Protein Info for GFF3725 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 900 926 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 39 to 60 (22 residues), see Phobius details amino acids 162 to 183 (22 residues), see Phobius details amino acids 203 to 224 (22 residues), see Phobius details amino acids 291 to 312 (22 residues), see Phobius details amino acids 324 to 343 (20 residues), see Phobius details amino acids 362 to 380 (19 residues), see Phobius details amino acids 403 to 424 (22 residues), see Phobius details amino acids 436 to 460 (25 residues), see Phobius details amino acids 480 to 503 (24 residues), see Phobius details amino acids 523 to 545 (23 residues), see Phobius details PF01435: Peptidase_M48" amino acids 81 to 280 (200 residues), 45.5 bits, see alignment E=4e-16

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (926 amino acids)

>GFF3725 hypothetical protein (Hydrogenophaga sp. GW460-11-11-14-LB1)
VWAALSSALVWLVVALCMGTVWLAVLATGSSVSSAFNVGASMASALALAVSGSIAAAYLW
RSSPRRHIKEVVHSPITEKAHELLEGESRKLNLPTPKLLVTRGDGIRDARVYFIGRRAAV
ILPETFSWLALIRPDELKAILSHELSHIANGDAWRGAVAHSAVVFTTVAVVVLSILVTAA
HAYQMAQIAASYTLLGAIRPRNLLGYFQALVMPLVCLAIVLAAYTTFLRLREYVADVTAA
TAGHRQAMRQIFSRAAAAVGRRENTLAFHPSAGSRLSRLKPLNFDRGPGPGAIFTATIAL
MAADSLFSVLLSGRPLNAPSMAQTAIHFVLSLLLFASLGLSFGRSPAFRGLRDRHWLAFR
QTALAIVGVFLGSLVVQWSLEMPRVVRVGAPIEVDLLAAVQEALFQSLLPVTTLLCSIAV
GALSRRSNSSGQLPEGALMVVAVVISNLASGATTGAFLWLTRNQLDLSQATNVFAFDDLV
GMGSLVLVVVAAGIAVVLAGLAFTGQAFRYFQRHNTGRRRQTAVLSGIALAVLACNSLAM
LGWATIATHISERETLWVRCDSLDVQELADALTTRLDTTLSGVATQRGKARARMQQASGC
SAQQQDPASAGGMLRKALSTLGRIQDSSLTLSRPNARDISARYEGASGRTWTWTLPVDTI
NLEQFTTELLVFHDPHRWAIHETDRDPKSMVAAEKLLIDLQERGSHHEKPWASLQLANFA
IARGAPGNAETHLRRAHALAPDSEVIQRLLAIVLLQQQKCDDAARFIPTLLVSQHLEVEH
LTRWSWCEAARGTPRDRLATLWKYRTRFSDSANLMANIGLSAYEVGSRDLATEYFRDAQA
LDPGNQEWCVPLYLACLTTTACPTPAPHDPPMQLNGALQNICWGWILRGRVAPESVARYW
RKAIEIRPDLARTRLSQDLDDLLRPK