Protein Info for GFF3723 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: FKBP-type peptidyl-prolyl cis-trans isomerase SlyD (EC 5.2.1.8)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 196 PF00254: FKBP_C" amino acids 4 to 80 (77 residues), 34.2 bits, see alignment E=1.3e-12

Best Hits

Swiss-Prot: 97% identical to SLYD_ECOL6: FKBP-type peptidyl-prolyl cis-trans isomerase SlyD (slyD) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K03775, FKBP-type peptidyl-prolyl cis-trans isomerase SlyD [EC: 5.2.1.8] (inferred from 100% identity to spt:SPA3321)

MetaCyc: 97% identical to FKBP-type peptidyl-prolyl cis-trans isomerase SlyD (Escherichia coli K-12 substr. MG1655)
Peptidylprolyl isomerase. [EC: 5.2.1.8]; RXN-22956 [EC: 5.2.1.8]

Predicted SEED Role

"FKBP-type peptidyl-prolyl cis-trans isomerase SlyD (EC 5.2.1.8)" in subsystem Peptidyl-prolyl cis-trans isomerase or Potassium homeostasis (EC 5.2.1.8)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 5.2.1.8

Use Curated BLAST to search for 5.2.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (196 amino acids)

>GFF3723 FKBP-type peptidyl-prolyl cis-trans isomerase SlyD (EC 5.2.1.8) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MKVAKDLVVSLAYQVRTEDGVLVDESPVSAPLDYLHGHGSLISGLETALEGHEVGDKFDV
AVGANDAYGQYDENLVQRVPKDVFMGVDELQVGMRFLAETDQGPVPVEITEVEDDHVVVD
GNHMLAGQNLKFNVEVVAIREATEEELAHGHVHGAHDHHHDHGEDGCCGGHGHDHGHEHG
GEGCCGGGGKGGCGCH