Protein Info for PS417_19045 in Pseudomonas simiae WCS417

Annotation: amino acid:proton symporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 420 signal peptide" amino acids 1 to 37 (37 residues), see Phobius details transmembrane" amino acids 49 to 72 (24 residues), see Phobius details amino acids 84 to 106 (23 residues), see Phobius details amino acids 154 to 172 (19 residues), see Phobius details amino acids 196 to 219 (24 residues), see Phobius details amino acids 231 to 250 (20 residues), see Phobius details amino acids 307 to 377 (71 residues), see Phobius details PF00375: SDF" amino acids 8 to 404 (397 residues), 382.8 bits, see alignment E=1e-118

Best Hits

Swiss-Prot: 41% identical to DCTA_RHILW: C4-dicarboxylate transport protein (dctA) from Rhizobium leguminosarum bv. trifolii (strain WSM2304)

KEGG orthology group: None (inferred from 92% identity to pba:PSEBR_a1786)

Predicted SEED Role

"Proton/glutamate symport protein @ Sodium/glutamate symport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U442 at UniProt or InterPro

Protein Sequence (420 amino acids)

>PS417_19045 amino acid:proton symporter (Pseudomonas simiae WCS417)
MNKNKLPRRIAVGIALGVLVGWACHHYAGSEQAAKALAGYFSMVTDIFLRMIKMIIAPLV
FATLVGGIASMGNSRSVGRIGMRAMLWFVTASLVSLMLGMALVNLFQPGAGLNMQVVQHA
TAAVPVNTGDFSLKTFISHVFPRSIAEAMANNEILQIVVFSLFFGFALAGVKRAGYTRIT
DTVDELAKVMFKITDYVMAFAPIGVFAAIASAITTNGLGLLADYAKLIAEFYLGIALLWV
LLFAAGYLFLGRSVFTLGKLIREPILLAFSTASSESAYPKTMEALEKFGAPKRVSSFVLP
LGYSFNLDGSMMYQAFAIMFIAQAYNIDLSFTQQLLILLTLMITSKGMAGVARASVVVVA
ATLPMFNLPEAGLLLIIGIDQFLDMARTATNVVGNSIATAVVAKSEAEEEPAELPQGARA