Protein Info for GFF3720 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Glutathione-regulated potassium-efflux system ancillary protein KefG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 100% identical to KEFG_SALA4: Glutathione-regulated potassium-efflux system ancillary protein KefG (kefG) from Salmonella agona (strain SL483)

KEGG orthology group: K11748, glutathione-regulated potassium-efflux system ancillary protein KefG (inferred from 100% identity to seg:SG3980)

MetaCyc: 43% identical to regulator of KefC-mediated potassium transport and quinone oxidoreductase (Escherichia coli K-12 substr. MG1655)
NAD(P)H dehydrogenase (quinone). [EC: 1.6.5.2]

Predicted SEED Role

"Glutathione-regulated potassium-efflux system ancillary protein KefG" in subsystem Glutathione-regulated potassium-efflux system and associated functions or Potassium homeostasis

MetaCyc Pathways

superpathway of photosynthetic hydrogen production (3/6 steps found)
vitamin K-epoxide cycle (1/4 steps found)

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.2

Use Curated BLAST to search for 1.6.5.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (183 amino acids)

>GFF3720 Glutathione-regulated potassium-efflux system ancillary protein KefG (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MSQPAKVLLLYAHPESQDSVANRVLLKPAIQHNNVTVHDLYARYPDFFIDTPYEQALLRE
HDVIVFQHPLYTYSCPALLKEWLDRVLSRGFASGPGGNQLVGKYWRSVITTGEPESAYRY
DALNRYPMSDVLRPFELTAAMCRMHWMPPIIVYWARRQSPQTLASHAKAYGEWLANPVSA
GGY