Protein Info for PS417_01895 in Pseudomonas simiae WCS417

Annotation: poly(R)-hydroxyalkanoic acid synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 560 TIGR01839: poly(R)-hydroxyalkanoic acid synthase, class II" amino acids 1 to 560 (560 residues), 1039.7 bits, see alignment E=0 PF07167: PhaC_N" amino acids 75 to 243 (169 residues), 222.3 bits, see alignment E=3.5e-70 PF00561: Abhydrolase_1" amino acids 237 to 487 (251 residues), 65 bits, see alignment E=8.9e-22

Best Hits

Swiss-Prot: 74% identical to PHAC2_PSEOL: Poly(3-hydroxyalkanoate) polymerase 2 (phaC2) from Pseudomonas oleovorans

KEGG orthology group: K03821, polyhydroxyalkanoate synthase [EC: 2.3.1.-] (inferred from 97% identity to pfs:PFLU0394)

MetaCyc: 73% identical to poly[R)-3-hydroxydecanoate polymerase (Pseudomonas putida GPo1)
RXN-11796 [EC: 2.3.1.304]

Predicted SEED Role

"Polyhydroxyalkanoic acid synthase" in subsystem Polyhydroxybutyrate metabolism

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.- or 2.3.1.304

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See U1UNP5 at UniProt or InterPro

Protein Sequence (560 amino acids)

>PS417_01895 poly(R)-hydroxyalkanoic acid synthase (Pseudomonas simiae WCS417)
MRERPVTNPAPTPAAFINAQNAITGLRGRDLLSTLRSVAAHGLRNPVHTVRHAWALSGQL
GRVLLGETVHEPNPNDGRFTDPTWTLNPLYRRSLQAYLSWQKQTRHWIDDSTLSADDRTR
AHFAFSLINDAVSPSNTLLNPLAIKELLNSGGNSVVRGVTHLLEDLLHNNGLPRQVSKHA
FEVGKTVATTPGSVVFRNELLELIQYKPMSEKQYAKPLLIVPPQINKYYIFDLSPANSFV
QYALKNGLQTFMVSWRNPDVRHREWGLSTYVAALEEALNVCRAITGAREVNLMGACAGGL
TIAALQGHLQAKRQLRRISSASYLVSLLDSQIDSPATLFADEQTLEAAKRRSYQQGVLDG
RDMAKVFAWMRPNDLIWNYWINNYLLGKEPPAFDILYWNNDNTRLPAALHGDLLDFFKHN
PLSHPGGLEVCGTPIDLQKVTVDSFSVAGINDHITPWDAVYRSTQLLGGERRFVLSNSGH
IQSILNPPGNPKANYVENPKLSSDPRAWYYDANHVEGSWWPQWLEWIQQRSGVQRETLTA
LGNQNYPPMEAAPGTYVRVR