Protein Info for GFF372 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: LSU ribosomal protein L28p

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 66 TIGR00009: ribosomal protein bL28" amino acids 2 to 46 (45 residues), 66 bits, see alignment E=1.6e-22 PF00830: Ribosomal_L28" amino acids 2 to 50 (49 residues), 73.6 bits, see alignment E=5.2e-25

Best Hits

Swiss-Prot: 100% identical to RL28_SALTY: 50S ribosomal protein L28 (rpmB) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K02902, large subunit ribosomal protein L28 (inferred from 96% identity to eco:b3637)

MetaCyc: 96% identical to 50S ribosomal subunit protein L28 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (66 amino acids)

>GFF372 LSU ribosomal protein L28p (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
VTGNNRSHALNATKRRFLPNLHSHRFWVESEKRFVTLRVSAKGMRIIDKKGIETVLSELR
ARGEKY