Protein Info for GFF3718 in Variovorax sp. SCN45

Annotation: Peroxyureidoacrylate/ureidoacrylate amidohydrolase RutB (EC 3.5.1.110)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03614: pyrimidine utilization protein B
  • amino acids 29 to 251 (223 residues), 402.2 bits, E=3.2e-125
• PF00857: Isochorismatase
  • amino acids 44 to 242 (199 residues), 139.7 bits, E=5.4e-45

Best Hits

Swiss-Prot: 92% identical to RUTB_VARPS: Peroxyureidoacrylate/ureidoacrylate amidohydrolase RutB (rutB) from Variovorax paradoxus (strain S110)

KEGG orthology group: K09020, putative isochorismatase family protein RutB [EC: 3.-.-.-] (inferred from 92% identity to vap:Vapar_4839)

MetaCyc: 67% identical to ureidoacrylate amidohydrolase (Escherichia coli K-12 substr. MG1655)
RXN-12896 [EC: 3.5.1.110]; 3.5.1.110 [EC: 3.5.1.110]

Predicted SEED Role

"Predicted amidohydrolase RutB in novel pyrimidine catabolism pathway" in subsystem Pyrimidine utilization

MetaCyc Pathways

• uracil degradation III (5/5 steps found)
• L-citrulline degradation (3/3 steps found)
• cyanate degradation (3/3 steps found)
• urea degradation I (3/3 steps found)
• L-arginine degradation V (arginine deiminase pathway) (3/4 steps found)
• cyanuric acid degradation II (3/5 steps found)
• superpathway of allantoin degradation in yeast (3/6 steps found)
• cyanuric acid degradation I (2/5 steps found)
• superpathway of atrazine degradation (3/8 steps found)
• allantoin degradation IV (anaerobic) (2/9 steps found)

KEGG Metabolic Maps

• Drug metabolism - other enzymes
• Glycosylphosphatidylinositol(GPI)-anchor biosynthesis
• Puromycin biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 3.-.-.-

Use Curated BLAST to search for 3.-.-.- or 3.5.1.110

Protein Sequence (263 amino acids)

>GFF3718 Peroxyureidoacrylate/ureidoacrylate amidohydrolase RutB (EC 3.5.1.110) (Variovorax sp. SCN45)
MNAPARNTTLTSSTPVGAPRLPGMPAPLVLPARPEPLAMHASDSALIVVDMQNAYASIGG
YVDSAGFDISGAQGTIANILRAIAAARAAGMLVVFLQNGWDAAYVEAGGPGSPNWHKSNA
LKTMRARPELQGKFLAKGGWDYELIDQMKPLPGDIVVPKTRYSGFFNSTLDSTLRARGIR
HLAFTGIATNVCVESTLRDAFHLEYFAVMLEDATHELGGPAIQKASVYNVETFFGWVSTV
DQFCTTFAPQAVSQPASAETAIA