Protein Info for GFF3718 in Variovorax sp. SCN45

Annotation: Peroxyureidoacrylate/ureidoacrylate amidohydrolase RutB (EC 3.5.1.110)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 263 TIGR03614: pyrimidine utilization protein B" amino acids 29 to 251 (223 residues), 402.2 bits, see alignment E=3.2e-125 PF00857: Isochorismatase" amino acids 44 to 242 (199 residues), 139.9 bits, see alignment E=4.9e-45

Best Hits

Swiss-Prot: 92% identical to RUTB_VARPS: Peroxyureidoacrylate/ureidoacrylate amidohydrolase RutB (rutB) from Variovorax paradoxus (strain S110)

KEGG orthology group: K09020, putative isochorismatase family protein RutB [EC: 3.-.-.-] (inferred from 92% identity to vap:Vapar_4839)

MetaCyc: 67% identical to ureidoacrylate amidohydrolase (Escherichia coli K-12 substr. MG1655)
RXN-12896 [EC: 3.5.1.110]; 3.5.1.110 [EC: 3.5.1.110]

Predicted SEED Role

"Predicted amidohydrolase RutB in novel pyrimidine catabolism pathway" in subsystem Pyrimidine utilization

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.-.-.-

Use Curated BLAST to search for 3.-.-.- or 3.5.1.110

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (263 amino acids)

>GFF3718 Peroxyureidoacrylate/ureidoacrylate amidohydrolase RutB (EC 3.5.1.110) (Variovorax sp. SCN45)
MNAPARNTTLTSSTPVGAPRLPGMPAPLVLPARPEPLAMHASDSALIVVDMQNAYASIGG
YVDSAGFDISGAQGTIANILRAIAAARAAGMLVVFLQNGWDAAYVEAGGPGSPNWHKSNA
LKTMRARPELQGKFLAKGGWDYELIDQMKPLPGDIVVPKTRYSGFFNSTLDSTLRARGIR
HLAFTGIATNVCVESTLRDAFHLEYFAVMLEDATHELGGPAIQKASVYNVETFFGWVSTV
DQFCTTFAPQAVSQPASAETAIA