Protein Info for GFF3711 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: FIG00638035: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 695 transmembrane" amino acids 20 to 50 (31 residues), see Phobius details amino acids 63 to 81 (19 residues), see Phobius details amino acids 87 to 104 (18 residues), see Phobius details amino acids 111 to 129 (19 residues), see Phobius details amino acids 135 to 156 (22 residues), see Phobius details amino acids 366 to 384 (19 residues), see Phobius details amino acids 390 to 407 (18 residues), see Phobius details amino acids 412 to 431 (20 residues), see Phobius details amino acids 436 to 453 (18 residues), see Phobius details amino acids 458 to 477 (20 residues), see Phobius details amino acids 483 to 505 (23 residues), see Phobius details TIGR01667: integral membrane protein, YccS/YhfK family" amino acids 12 to 674 (663 residues), 821.3 bits, see alignment E=3e-251 PF12805: FUSC-like" amino acids 63 to 330 (268 residues), 235.9 bits, see alignment E=7.7e-74 PF04632: FUSC" amino acids 369 to 586 (218 residues), 40.1 bits, see alignment E=3e-14 PF13515: FUSC_2" amino acids 376 to 498 (123 residues), 88.1 bits, see alignment E=7.9e-29

Best Hits

Swiss-Prot: 87% identical to YHFK_ECOLI: Uncharacterized protein YhfK (yhfK) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 92% identity to cko:CKO_04778)

Predicted SEED Role

"FIG00638035: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (695 amino acids)

>GFF3711 FIG00638035: hypothetical protein (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MWRRLIYHPEINYALRQTLVLCLPVAVGLLIGQLHLGLLFSLVPACCNIAGLDTPHKRFF
KRLIIGASLFAGCSLVTQLLLAESIPLPLILTGLTLVLGVTAEISPLHARLLPASLIAAI
FTLSLAGYMPVWEPLLIYALGTLWYGVFNWFWFWLWREQPLRESLSLLYRELADYCEAKY
SLLTQHIDPEKALPPLLIRQQKAVDLITQCYQQMHMLSAHNNNDYKRLLRAFQEAMDLQE
HISVSLHQPEEVQKLVERSHAEEVIRWNAQTVAARLRVLADDILYHRLPTRFSMEKQIGA
LEKIANQHPENPVGQFCYWHFSRIARVLRTQRPLYARDLMADKQRRLPLLPALKNYMSLK
SPALRNAGRISVMMSIASLMGSALHLPKPYWILMTVLFVTQNGYGATRVRILHRSVGTLV
GLVIAGVTLHLHIPESITLAVMLVLTLASYLIIRKNYGWATVGFTVTAVYTIQLLTLNGE
QFIVPRLIDTLIGCLIAFGGMVWLWPQWQSGLLRKNAHDALEAAQEAIRLILSNDPQATP
LAYQRMRVNQAHNTLFNSLNQAMQEPGFNTHYLSDMKLWVTHSQFIVEHINAMTTLAREH
TMLTPDLAQRYLESCEIAIQRCQQRLEYDRPGGSGDVNILESPDMPSHGLLSTLEQHLQR
IIGHLNTMHTISSMAWRQRPHHGIWLSKRLRDTKG