Protein Info for PS417_18990 in Pseudomonas simiae WCS417

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 403 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 39 to 66 (28 residues), see Phobius details amino acids 79 to 100 (22 residues), see Phobius details amino acids 106 to 131 (26 residues), see Phobius details amino acids 146 to 168 (23 residues), see Phobius details amino acids 182 to 203 (22 residues), see Phobius details amino acids 233 to 253 (21 residues), see Phobius details amino acids 264 to 282 (19 residues), see Phobius details amino acids 302 to 322 (21 residues), see Phobius details amino acids 332 to 351 (20 residues), see Phobius details amino acids 357 to 379 (23 residues), see Phobius details PF04143: Sulf_transp" amino acids 54 to 380 (327 residues), 244.3 bits, see alignment E=1.1e-76

Best Hits

KEGG orthology group: K07112, (no description) (inferred from 95% identity to pfs:PFLU4280)

Predicted SEED Role

"FIG00954845: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See U1TAH0 at UniProt or InterPro

Protein Sequence (403 amino acids)

>PS417_18990 membrane protein (Pseudomonas simiae WCS417)
MSTSLPLTPARRPLAPLVAFIILVLGALFLQNSVGSRQVLLLVVGAALGLTLYHAAFGFT
SAWRVFINDRRGAGLRAQMVMLAIAVLLFFPALGAGSLFGQPVVGLVAPAGLSVVFGAFI
FGIGMQLGGGCASGTLFTVGGGNARMLVTLFFFICGSLIATHHVDWWFALPSFPAVSIVK
SFGVVPAMGLSLAVFAIIALVTVRLEKGRHGQLEEGVKSEHQGLHRFLRGPWPLVWGAIG
LALLNYATLALAGRPWGITSAFALWGAKVASGLGVDVASWAFWQMPGNAKALAAPVWEDI
TSVMDIGIVLGALLAAGLAGRFAPSLKIPTRSLVAAVIGGLLLGYGSRLAYGCNIGAYFS
GIASGSLHGWVWLVAAFIGNSVGVRLRPLFFAGERPQVALSGC