Protein Info for PS417_18980 in Pseudomonas simiae WCS417

Annotation: 3-methyl-2-oxobutanoate hydroxymethyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 271 PF02548: Pantoate_transf" amino acids 9 to 264 (256 residues), 317.5 bits, see alignment E=3.4e-99 TIGR00222: 3-methyl-2-oxobutanoate hydroxymethyltransferase" amino acids 10 to 269 (260 residues), 276.3 bits, see alignment E=1.4e-86

Best Hits

Swiss-Prot: 76% identical to PANB1_PSEF5: 3-methyl-2-oxobutanoate hydroxymethyltransferase 1 (panB1) from Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)

KEGG orthology group: K00606, 3-methyl-2-oxobutanoate hydroxymethyltransferase [EC: 2.1.2.11] (inferred from 80% identity to ppg:PputGB1_1832)

MetaCyc: 46% identical to 3-methyl-2-oxobutanoate hydroxymethyltransferase (Thermococcus kodakarensis)
3-methyl-2-oxobutanoate hydroxymethyltransferase. [EC: 2.1.2.11]

Predicted SEED Role

"3-methyl-2-oxobutanoate hydroxymethyltransferase (EC 2.1.2.11)" in subsystem Coenzyme A Biosynthesis (EC 2.1.2.11)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.2.11

Use Curated BLAST to search for 2.1.2.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U1L2 at UniProt or InterPro

Protein Sequence (271 amino acids)

>PS417_18980 3-methyl-2-oxobutanoate hydroxymethyltransferase (Pseudomonas simiae WCS417)
MSIHTRTKRLTVPQLVAMKGQQKIVSLTAYSSAIAKLIDPVVDFILVGDSTAMVGYGRPS
TLSMQLEEIIGHTRAVVDSTRLACVIADMPFGSYQESNEQAFRNCAQVLARTGCDAVKLE
ANQALAGTVEFLVARGIPVMAHVGLMPQFVNVMGGFKAQGLTAEAGARIAEDARANLQAG
AFSLLLEGVAEGVARQITLDSKMPTIGIGASPACDGQVLVTEDVLGLGGEHLPRFVKQYA
DVGAVIRDACERFAEEVRHGRFPEARHCYGL