Protein Info for GFF3709 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Para-aminobenzoate synthase, amidotransferase component (EC 2.6.1.85)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 187 TIGR00566: glutamine amidotransferase of anthranilate synthase or aminodeoxychorismate synthase" amino acids 1 to 187 (187 residues), 311.6 bits, see alignment E=1e-97 PF00117: GATase" amino acids 3 to 185 (183 residues), 217.5 bits, see alignment E=1.3e-68 PF07722: Peptidase_C26" amino acids 64 to 170 (107 residues), 33.3 bits, see alignment E=4.4e-12

Best Hits

Swiss-Prot: 100% identical to PABA_SALTY: Aminodeoxychorismate synthase component 2 (pabA) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K01664, para-aminobenzoate synthetase component II [EC: 2.6.1.85] (inferred from 98% identity to see:SNSL254_A3740)

MetaCyc: 85% identical to aminodeoxychorismate synthase subunit 2 (Escherichia coli K-12 substr. MG1655)
Aminodeoxychorismate synthase. [EC: 2.6.1.85]

Predicted SEED Role

"Para-aminobenzoate synthase, amidotransferase component (EC 2.6.1.85)" in subsystem Chorismate: Intermediate for synthesis of PAPA antibiotics, PABA, anthranilate, 3-hydroxyanthranilate and more. or Folate Biosynthesis or Tryptophan synthesis (EC 2.6.1.85)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.6.1.85

Use Curated BLAST to search for 2.6.1.85

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (187 amino acids)

>GFF3709 Para-aminobenzoate synthase, amidotransferase component (EC 2.6.1.85) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MILLIDNYDSFTWNLYQYFCELGAEVQVRRNDALTLAHIDALNPQKIVISPGPCTPNDAG
ISLAVIRHYAGRIPMLGVCLGHQAMAQAFGASVVRAAKVMHGKTSPVTHNGQGVFRGLPS
PLTVTRYHSLIVDPATLPECFEITAWSETQEIMGIRHREWDLEGVQFHPESILSEQGHAL
LKNFLRR