Protein Info for GFF3707 in Variovorax sp. SCN45

Annotation: ABC transporter, permease protein 1 (cluster 11, riboflavin/purine nucleoside/unknown)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 373 transmembrane" amino acids 37 to 60 (24 residues), see Phobius details amino acids 80 to 101 (22 residues), see Phobius details amino acids 113 to 130 (18 residues), see Phobius details amino acids 136 to 157 (22 residues), see Phobius details amino acids 167 to 188 (22 residues), see Phobius details amino acids 211 to 232 (22 residues), see Phobius details amino acids 262 to 282 (21 residues), see Phobius details amino acids 288 to 307 (20 residues), see Phobius details amino acids 313 to 335 (23 residues), see Phobius details amino acids 341 to 360 (20 residues), see Phobius details PF02653: BPD_transp_2" amino acids 82 to 353 (272 residues), 128.6 bits, see alignment E=1.2e-41

Best Hits

KEGG orthology group: K02057, simple sugar transport system permease protein (inferred from 92% identity to vap:Vapar_4849)

Predicted SEED Role

"Ribose ABC transport system, permease protein RbsC (TC 3.A.1.2.1)" in subsystem D-ribose utilization (TC 3.A.1.2.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (373 amino acids)

>GFF3707 ABC transporter, permease protein 1 (cluster 11, riboflavin/purine nucleoside/unknown) (Variovorax sp. SCN45)
MASAPKTIAAKSPQPQPLARRRYALEIRQHMAWRWQALILAAALLVGFAISAAILVMAGV
PADELANEFVTQTFLDGQNFRAVLFQAAPMILVGLAGAIAFRARFWNLGLEGQMIWGAIG
ATAVSMWQIGPENLRLPLMFVAAVGCGLLWVLGPAWLKLKLGVNEIISTLMLNYMAANFL
LHLVYGSWKDPKDNFPYSPQFRAFERLPEIGAGVGSSILLAGVVALLAWWLVSVSRAGLY
LRFVDANPRVAHANGVPVRRTIYGAVLLSGAMAGLAGFAVAAGQEGRLTQAFYQGYGFSG
ILIAFLARNNPLAATVVALLVAALFVTGRSLQVFYQVPFSMVQLIQAIIVVCVASSDFFI
RHRLRRVGAEASA