Protein Info for GFF3702 in Xanthobacter sp. DMC5

Annotation: Formyltransferase/hydrolase complex Fhc subunit C

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03122: formylmethanofuran dehydrogenase subunit C
  • amino acids 5 to 266 (262 residues), 187.9 bits, E=1.1e-59

Best Hits

Swiss-Prot: 42% identical to FHCC_METEA: Formyltransferase/hydrolase complex Fhc subunit C (fhcC) from Methylobacterium extorquens (strain ATCC 14718 / DSM 1338 / JCM 2805 / NCIMB 9133 / AM1)

KEGG orthology group: K00202, formylmethanofuran dehydrogenase subunit C [EC: 1.2.99.5] (inferred from 67% identity to xau:Xaut_1793)

MetaCyc: 42% identical to formyltransferase/hydrolase complex gamma subunit (Methylorubrum extorquens AM1)
RXN-2884

Predicted SEED Role

No annotation

MetaCyc Pathways

• formaldehyde oxidation VI (H₄MPT pathway) (4/4 steps found)
• superpathway of C1 compounds oxidation to CO₂ (8/12 steps found)

KEGG Metabolic Maps

• Folate biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 1.2.99.5

Use Curated BLAST to search for 1.2.99.5

Protein Sequence (268 amino acids)

>GFF3702 Formyltransferase/hydrolase complex Fhc subunit C (Xanthobacter sp. DMC5)
MSGFRLTLKAPLSARVDASSLLPAALAGASAADVAGRTVPFGTGVALVGDLFEITAGSDE
VVVFSGDPRLDYLGAGLAAGEIRVEGSVGAGAGAGMSGGRLVISGDAGDGLAAGLTGGRI
EVFGSAGKNVGGPRPGERQGMRGGVVSVAGRVGDGLGARLRGGLILVGGDAGAGAADGLL
AGTLAVAGRLGPGAGRGMKRGSILVSSAPEALAPGFAEAGPQDFVALKLLARRVPELAAL
FGGTLSGRAVRLVGNRLAGGEGEILVLS