Protein Info for GFF3699 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 594 transmembrane" amino acids 31 to 56 (26 residues), see Phobius details amino acids 76 to 97 (22 residues), see Phobius details amino acids 151 to 170 (20 residues), see Phobius details amino acids 175 to 194 (20 residues), see Phobius details amino acids 257 to 276 (20 residues), see Phobius details amino acids 296 to 317 (22 residues), see Phobius details PF00664: ABC_membrane" amino acids 32 to 306 (275 residues), 167.1 bits, see alignment E=7e-53 PF00005: ABC_tran" amino acids 373 to 521 (149 residues), 113.4 bits, see alignment E=1.3e-36

Best Hits

KEGG orthology group: K06147, ATP-binding cassette, subfamily B, bacterial (inferred from 78% identity to rfr:Rfer_1512)

Predicted SEED Role

"ABC transporter ATP-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (594 amino acids)

>GFF3699 ABC transporter ATP-binding protein (Hydrogenophaga sp. GW460-11-11-14-LB1)
MPMPSSDRPKAESPTSLGGLLPFMRPYRTQIVLAMLFLVLAAVATLLFPVALRGLIDGGL
VAGDRSAQAMGLRGHFLELFAVAVALGLFSAARFYLVSWLGERITADLRHAVYSHVLRQS
PQFFETTQTGEVLSRLTTDTTLVQTVVGSSLSMGLRNGVMGIGALIMLVWTNPYVMLQVL
LIILLVVLPSMWFGRRVRKLSRASQDRVADSSAIAAEVLNAIPIVQSYTAEDRESLRFKD
STESAFVTAIRRTKARAGMVAFIIISTAALLLWGLYQGTQAVLAGTITPGHLGQTVVYII
ILAGAVGVLGEVYGDLLRAAGASERLMELLASESPVQSPARPLQAPAPQGGSALAFDDVS
FHYPSRPTQAALSGFTLAVQPGQTVALVGPSGAGKTTVFGLLLRYYDPALGSIRLDGVPI
DQLDLHALRQRIGIVPQDPVIFSSSALENIRYGKPGASDAEVRAAAAAAFADEFIEKLPE
GYDTFLGERGVRLSGGQRQRIAIARAMLKNPPLLLLDEATSALDAQSERMVQAALESAMK
DRTTLVIAHRLATVQQADRIVVLDHGRLVEQGTHAELVAHGGVYAGLAALQFNA