Protein Info for GFF3694 in Xanthobacter sp. DMC5

Annotation: Thiamine-phosphate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 211 PF02581: TMP-TENI" amino acids 9 to 190 (182 residues), 194 bits, see alignment E=7.4e-62 TIGR00693: thiamine-phosphate diphosphorylase" amino acids 9 to 202 (194 residues), 204.9 bits, see alignment E=3.8e-65

Best Hits

Swiss-Prot: 85% identical to THIE_XANP2: Thiamine-phosphate synthase (thiE) from Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)

KEGG orthology group: K00788, thiamine-phosphate pyrophosphorylase [EC: 2.5.1.3] (inferred from 85% identity to xau:Xaut_1867)

MetaCyc: 43% identical to thiamine phosphate synthase (Bacillus subtilis subtilis 168)
Thiamine-phosphate diphosphorylase. [EC: 2.5.1.3]; 2.5.1.3 [EC: 2.5.1.3]

Predicted SEED Role

"Thiamin-phosphate pyrophosphorylase (EC 2.5.1.3)" in subsystem Thiamin biosynthesis (EC 2.5.1.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.3

Use Curated BLAST to search for 2.5.1.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (211 amino acids)

>GFF3694 Thiamine-phosphate synthase (Xanthobacter sp. DMC5)
MSRPFDLTLYLVTDPRLVAARGLVATVAAVVKGGATIVQLRDPDAHGRALVEQARALKAL
LAPLRIPLIINDRVDVAVAADADGVHLGQDDMTPADARALLGPERILGLSVGNPAEFAAS
DVGVVDYLGVGPVKATGTKKDAGAAIGTSGVTAVRALTRLPIVGIGGIDGALAAEVIRAG
ADGVAVVSAICAAPDPEHAARALLSAVTAAR