Protein Info for GFF3692 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: NADH-ubiquinone oxidoreductase chain L (EC 1.6.5.3)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 683 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 40 to 61 (22 residues), see Phobius details amino acids 73 to 91 (19 residues), see Phobius details amino acids 96 to 114 (19 residues), see Phobius details amino acids 126 to 143 (18 residues), see Phobius details amino acids 149 to 168 (20 residues), see Phobius details amino acids 189 to 207 (19 residues), see Phobius details amino acids 227 to 243 (17 residues), see Phobius details amino acids 264 to 282 (19 residues), see Phobius details amino acids 294 to 315 (22 residues), see Phobius details amino acids 322 to 348 (27 residues), see Phobius details amino acids 354 to 371 (18 residues), see Phobius details amino acids 389 to 410 (22 residues), see Phobius details amino acids 430 to 451 (22 residues), see Phobius details amino acids 497 to 518 (22 residues), see Phobius details amino acids 556 to 580 (25 residues), see Phobius details amino acids 660 to 681 (22 residues), see Phobius details TIGR01974: proton-translocating NADH-quinone oxidoreductase, chain L" amino acids 12 to 678 (667 residues), 799.2 bits, see alignment E=1.9e-244 PF00662: Proton_antipo_N" amino acids 77 to 127 (51 residues), 79.4 bits, see alignment 1.4e-26 PF00361: Proton_antipo_M" amino acids 143 to 421 (279 residues), 265.8 bits, see alignment E=4.5e-83

Best Hits

Swiss-Prot: 66% identical to NUOL_NEIMA: NADH-quinone oxidoreductase subunit L (nuoL) from Neisseria meningitidis serogroup A / serotype 4A (strain Z2491)

KEGG orthology group: K00341, NADH dehydrogenase I subunit L [EC: 1.6.5.3] (inferred from 84% identity to aav:Aave_1274)

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain L (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (683 amino acids)

>GFF3692 NADH-ubiquinone oxidoreductase chain L (EC 1.6.5.3) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MSTTLSASTLLAVPLAPLLGSAIAGILGTTFGGNVIGRRASHTFTILGVLVAFILSAMTL
KSVAVDGARFNETIYTWMVVGGLKMEIGFLVDGLTAMMMVVVTFVSLMVHLYTIGYMEED
DGYNRFFAYISLFTFSMLMLVMSNNLLQLFFGWEAVGLVSYLLIGFWFNKPTAIFANMKA
FLVNRVGDFGFILGIGLIVAYAGTMNYTEVFAKAPELGALGFPGTDWMLITVICICLFIG
AMGKSAQFPLHVWLPDSMEGPTPISALIHAATMVTAGIFMVARMSPLFELSDTALNFILV
IGAITALFMGFLGIIQNDIKRVVAYSTLSQLGYMTVALGASAYSVAVFHLMTHAFFKALL
FLAAGSVIMGLHHNQDIRWMGGVRKYMPITWITSLLGTLALIGTPLFSGFYSKDSIIEAV
HFSTLPAAGFAHFAVLAGVFVTSFYSFRLYFLVFHGKERYDQNPDAHHGHHDDHGDHHDD
HGHGHGHGDGKPHESPWVVTVPLLLLAIPSVVIGFMTIQPMLFGDFFKDAITINSAAHPA
MAKFGEMFHGPLAMAVHALSTAPLYLALAGAVCAWYMYLINPAVPAAIARALRPLIVVLE
NKYYLDWFNENVLARGARALGVGLWKGGDRGVIEGGVVNASWKLVGVVSSVVRRAQTGYL
YHYALMMIVGVLLFMTYFVWLAK