Protein Info for GFF3686 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: NADH-ubiquinone oxidoreductase chain F (EC 1.6.5.3)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 457 TIGR01959: NADH oxidoreductase (quinone), F subunit" amino acids 35 to 447 (413 residues), 619.8 bits, see alignment E=7.7e-191 PF01512: Complex1_51K" amino acids 81 to 251 (171 residues), 154.1 bits, see alignment E=4.2e-49 PF10531: SLBB" amino acids 275 to 323 (49 residues), 40.5 bits, see alignment 3e-14 PF10589: NADH_4Fe-4S" amino acids 364 to 445 (82 residues), 112.4 bits, see alignment E=1.1e-36

Best Hits

Swiss-Prot: 56% identical to NUOF_RICB8: NADH-quinone oxidoreductase subunit F (nuoF) from Rickettsia bellii (strain OSU 85-389)

KEGG orthology group: K00335, NADH dehydrogenase I subunit F [EC: 1.6.5.3] (inferred from 83% identity to pol:Bpro_3251)

MetaCyc: 50% identical to NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial (Homo sapiens)

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain F (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (457 amino acids)

>GFF3686 NADH-ubiquinone oxidoreductase chain F (EC 1.6.5.3) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MNADQILGQFRATGVQTCFHGRHIEPQIYAGLDGSNWSLKDYVARGGYQALRKVLGQDGS
PPAGDPPVVGMTQDQVIATLKESALRGRGGAGFPTGLKWSFMPRQFPGQKYLVCNSDEGE
PGTCKDRDILLYNPHIVIEGMAIAAYAMGISVGYNYIHGEIFEAYERFEAALEEARAAGF
LGDGIMGSGFNFQLHAAHGFGAYICGEETALLESLEGKKGQPRFKPPFPASFGLYGKPTT
INNTETFAAVPWIIRNGGAAYLACGKPNNGGTKIYSVSGDVEMPGNYEVPLGTPFSKLLE
LAGGVRKGRTLKAVIPGGSSAPVLPAHIMMECTMDYDSIAKAGSMLGSGAVIVMDDSRCM
VESLKRLSYFYMHESCGQCTPCREGTGWLWRMVDRIDRGEGKPADMALLDNVAENIMGRT
ICALGDAAAMPVRAMIKHFRHEFEAKITAAQTPAKAA