Protein Info for GFF3685 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: NADH-ubiquinone oxidoreductase chain E (EC 1.6.5.3)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 170 TIGR01958: NADH-quinone oxidoreductase, E subunit" amino acids 18 to 163 (146 residues), 176.9 bits, see alignment E=1.3e-56 PF01257: 2Fe-2S_thioredx" amino acids 19 to 163 (145 residues), 155.9 bits, see alignment E=3.3e-50

Best Hits

Swiss-Prot: 38% identical to NUOE_RICFE: NADH-quinone oxidoreductase subunit E (nuoE) from Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)

KEGG orthology group: K00334, NADH dehydrogenase I subunit E [EC: 1.6.5.3] (inferred from 75% identity to aav:Aave_1267)

MetaCyc: 31% identical to NADH-quinone oxidoreductasesubunit E (Pseudomonas putida KT2440)
NADH-DEHYDROG-A-RXN [EC: 7.1.1.2]

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain E (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3 or 7.1.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (170 amino acids)

>GFF3685 NADH-ubiquinone oxidoreductase chain E (EC 1.6.5.3) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MSTVTPESFSDATIRRFDREAAKYPDEQRISAVMACLSIIQQEAGHVSPEAEVALAAYLR
VEPIAVHEVTTFYNMYNQRPVGKFKLNVCTNLPCQLRDGNKALHHLEQKLGITMGETTAD
GLFTLQQSECLGACADSPVMLVNDRHMCSFMSNEKLDQLVDGLRASEGQA