Protein Info for GFF3682 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: NADH-ubiquinone oxidoreductase chain B (EC 1.6.5.3)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01957: NADH-quinone oxidoreductase, B subunit
  • amino acids 10 to 152 (143 residues), 254.6 bits, E=1.2e-80
• PF01058: Oxidored_q6
  • amino acids 36 to 146 (111 residues), 92.8 bits, E=7.5e-31

Best Hits

Swiss-Prot: 96% identical to NUOB_ACIET: NADH-quinone oxidoreductase subunit B (nuoB) from Acidovorax ebreus (strain TPSY)

KEGG orthology group: K00331, NADH dehydrogenase I subunit B [EC: 1.6.5.3] (inferred from 94% identity to adn:Alide_1047)

MetaCyc: 56% identical to ferredoxin-menaquinone dehydrogenase subunit B (Helicobacter pylori 26695)
7.1.1.-

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain B (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

• aerobic respiration III (alternative oxidase pathway) (3/3 steps found)
• aerobic respiration I (cytochrome c) (3/4 steps found)
• NADH to cytochrome bd oxidase electron transfer I (1/2 steps found)
• NADH to cytochrome bo oxidase electron transfer I (1/2 steps found)
• NAD(P)/NADPH interconversion (3/6 steps found)
• Fe(II) oxidation (2/6 steps found)

KEGG Metabolic Maps

• Oxidative phosphorylation

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Protein Sequence (159 amino acids)

>GFF3682 NADH-ubiquinone oxidoreductase chain B (EC 1.6.5.3) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MIEGVFKEGFVTTSYDSVVNWAKTGSLWPMTFGLACCAVEMMHAAAARYDIGRFGSEVFR
ASPRQSDLMIVAGTLCNKMAPALRKVYDQMAEPRWVLSMGSCANGGGYYHYSYSVVRGCD
RIVPVDVYVPGCPPTAEALLYGIIQLQQKIRRTHTIARA