Protein Info for PS417_18835 in Pseudomonas simiae WCS417

Annotation: peptide transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 578 transmembrane" amino acids 20 to 39 (20 residues), see Phobius details amino acids 46 to 66 (21 residues), see Phobius details amino acids 86 to 108 (23 residues), see Phobius details amino acids 115 to 136 (22 residues), see Phobius details amino acids 174 to 195 (22 residues), see Phobius details amino acids 215 to 241 (27 residues), see Phobius details amino acids 271 to 293 (23 residues), see Phobius details amino acids 314 to 333 (20 residues), see Phobius details amino acids 339 to 359 (21 residues), see Phobius details amino acids 422 to 443 (22 residues), see Phobius details amino acids 482 to 502 (21 residues), see Phobius details amino acids 515 to 540 (26 residues), see Phobius details amino acids 552 to 575 (24 residues), see Phobius details PF03169: OPT" amino acids 17 to 573 (557 residues), 357.2 bits, see alignment E=1e-110

Best Hits

KEGG orthology group: None (inferred from 92% identity to pfs:PFLU4254)

Predicted SEED Role

"Oligopeptide transporter, OPT family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U9E9 at UniProt or InterPro

Protein Sequence (578 amino acids)

>PS417_18835 peptide transporter (Pseudomonas simiae WCS417)
MTSAPPTTLPHGPVTRELSLRAVITGSVLGILLTPSNVYAGLKIGWSFNMSIIALLIGYA
IFQGVAKRSTEHLPWTLHESNINQTVASAAASIISGGLVAPIPAYTLLTGNQLDAVPMIA
WVFSVSFLGIWIAWYLRPSLLNDKALKFPEGMATLETLLHIYNHGREAATRLKVLLSAAL
LSGLVKWVDTFMWAFPRWSPSAQLERLTFTADPSLLLVGFGGIIGIRVGLTLLLGALLAW
GGLGPWLLAQHLVTLPADSSGPQFAALVEWLLWPGVSLMVCSTLASLAIRLWALYRSTHS
SGGSTWTVPKPGPAAGFALAIVLVVSLQALLFGINLGMALLTIPLAICLAAVAARVVGAT
GIPPIGAIGQLSQLSFGIVAPGQVPINLMSANTAGGAAGQCTDLMNDFKVGKAIGATPHK
QVIAQILGIFIGSIVGVFAYLALIPDPQSMLLTEEWPAPAVATWKAVAQTLTHGLDSLST
SIRWAIVIGGLVGVVLGVLDSTLPAHRARFLPSAAALGLAFVLPASVSLMMALGAILTWL
VSCRWPSLTERFAITAAAGLIAGESITGVGASLWSMVS