Protein Info for GFF368 in Variovorax sp. SCN45

Annotation: Dihydropteroate synthase (EC 2.5.1.15)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 272 PF00809: Pterin_bind" amino acids 1 to 242 (242 residues), 248.7 bits, see alignment E=3.4e-78 TIGR01496: dihydropteroate synthase" amino acids 1 to 257 (257 residues), 286.1 bits, see alignment E=1.5e-89

Best Hits

Swiss-Prot: 51% identical to DHPS_NEIMB: Dihydropteroate synthase (folP) from Neisseria meningitidis serogroup B (strain MC58)

KEGG orthology group: K00796, dihydropteroate synthase [EC: 2.5.1.15] (inferred from 88% identity to vpe:Varpa_3302)

Predicted SEED Role

"Dihydropteroate synthase (EC 2.5.1.15)" in subsystem Folate Biosynthesis (EC 2.5.1.15)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.15

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (272 amino acids)

>GFF368 Dihydropteroate synthase (EC 2.5.1.15) (Variovorax sp. SCN45)
MGIVNVTPDSFSDGGAHASTSTALKHCEQLLKEGADILDIGGESTRPGSPAVPLDAELAR
VLPVVREAVKLNVPLSIDTYKPEVMRAVLDLGADIVNDIWALRQPGAREAVAAHPSCGIC
LMHMHRDPQTMQAVPMSGDVIPQVLSFLQAQVQLLRALKVDASRITLDPGVGFGKTVAQN
FALLARQRELLDGGGLPLLLGWSRKSSIGAVTGIEAAGERIVPSVAAAVLAVDRGAAVVR
VHDVRDTVAAIAVWRAMRAEEPRQTQQDREQP