Protein Info for GFF3678 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Quinone oxidoreductase (EC 1.6.5.5)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 329 TIGR02824: putative NAD(P)H quinone oxidoreductase, PIG3 family" amino acids 1 to 327 (327 residues), 479.2 bits, see alignment E=2.8e-148 PF08240: ADH_N" amino acids 28 to 101 (74 residues), 28.2 bits, see alignment E=2.2e-10 PF00107: ADH_zinc_N" amino acids 154 to 278 (125 residues), 112.5 bits, see alignment E=2.2e-36 PF13602: ADH_zinc_N_2" amino acids 186 to 326 (141 residues), 92.5 bits, see alignment E=7.2e-30

Best Hits

KEGG orthology group: None (inferred from 80% identity to dia:Dtpsy_0869)

Predicted SEED Role

"Quinone oxidoreductase (EC 1.6.5.5)" in subsystem ZZ gjo need homes (EC 1.6.5.5)

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.5

Use Curated BLAST to search for 1.6.5.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (329 amino acids)

>GFF3678 Quinone oxidoreductase (EC 1.6.5.5) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MQAVEISAPGAPDVLRLGERPVPVAGAGEALIRVSASGVNRPDVLQRTGNYPVPPGASDI
PGLEVAGVIESGDAAALAEAGLKVGDRVCALVAGGGYAQWCVAPVGQCLPVPEGLDDIAA
ASLPETFFTVWSNVFDRGRLQAGETLLVQGGTSGIGVTAIQMAKALGARVIATAGSDDKC
AACLQLGADHAINYKTQDFVAAAAELTGKRGVDVILDMVAGSYVSREIECLAEDGRLVII
AVQGGVKAEFNAGLVLRRRLTITGSTLRPRPVAFKAAIAASLRARVWPLLAEGRIRPVIH
QVFPAAQAAESHTLMESNQHIGKLVLSWA