Protein Info for GFF3675 in Variovorax sp. SCN45

Annotation: Octanoate-[acyl-carrier-protein]-protein-N-octano yltransferase (EC 2.3.1.181)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00214: lipoyl(octanoyl) transferase
  • amino acids 33 to 137 (105 residues), 110.3 bits, E=4.3e-36

Best Hits

Swiss-Prot: 85% identical to LIPB_VARPS: Octanoyltransferase (lipB) from Variovorax paradoxus (strain S110)

KEGG orthology group: K03801, lipoyl(octanoyl) transferase [EC: 2.3.1.181] (inferred from 84% identity to vpe:Varpa_5518)

Predicted SEED Role

"Octanoate-[acyl-carrier-protein]-protein-N-octanoyltransferase" in subsystem Lipoic acid metabolism

MetaCyc Pathways

• lipoate biosynthesis and incorporation I (2/2 steps found)
• lipoate biosynthesis and incorporation III (Bacillus) (2/3 steps found)
• lipoate biosynthesis and incorporation V (mammals) (2/3 steps found)
• lipoate biosynthesis and incorporation IV (yeast) (4/7 steps found)

KEGG Metabolic Maps

• Lipoic acid metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.181

Protein Sequence (242 amino acids)

>GFF3675 Octanoate-[acyl-carrier-protein]-protein-N-octano yltransferase (EC 2.3.1.181) (Variovorax sp. SCN45)
MTDTAIAPSAIELHPLGRVDYAETFAAMQQFTLERTPETPDALWICEHAPVFTQGIAGKQ
DHILNPGAIPVVQTNRGGQVTFHGPGQVVAYPLIDLRRAGYFVKEYVYRIEESVLRTLAH
FGVTGHRVPGAPGIYVRLDDPFSHAMLKASPLPGSALTGPLPAADPFRGLGKIAALGIKV
SRHATYHGVALNVEMDLEPFSRINPCGYAGLQTVDLSTIGIQTTWEEAATVLSQKLRAFL
AP