Protein Info for GFF3674 in Variovorax sp. SCN45

Annotation: Lipoyl synthase (EC 2.8.1.8)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 333 PF16881: LIAS_N" amino acids 35 to 80 (46 residues), 30.1 bits, see alignment 5.6e-11 TIGR00510: lipoyl synthase" amino acids 37 to 324 (288 residues), 423.9 bits, see alignment E=1.8e-131 PF04055: Radical_SAM" amino acids 95 to 258 (164 residues), 92 bits, see alignment E=5.1e-30

Best Hits

Swiss-Prot: 98% identical to LIPA_VARPS: Lipoyl synthase (lipA) from Variovorax paradoxus (strain S110)

KEGG orthology group: K03644, lipoic acid synthetase [EC: 2.8.1.8] (inferred from 98% identity to vap:Vapar_4881)

MetaCyc: 63% identical to lipoyl synthase (Escherichia coli K-12 substr. MG1655)
Lipoyl synthase. [EC: 2.8.1.8]

Predicted SEED Role

"Lipoate synthase" in subsystem Lipoic acid metabolism

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.8.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (333 amino acids)

>GFF3674 Lipoyl synthase (EC 2.8.1.8) (Variovorax sp. SCN45)
MSTTEVVRDAQSAETYNPLAKQKAAAKLSRIPVKVVQTGEVLKKPDWIRVKAGSPTTRFY
EIKQILRESNLHTVCEEASCPNIGECFGNGTATFMIMGDKCTRRCPFCDVGHGRPDPLDK
DEPLNLAKTIAKLRLKYVVITSVDRDDLRDGGSQHFVDCISNIRELSPMTQIEILVPDFR
GRDDRALEILKAAPPDVMNHNLETAPRLYKEARPGSDYQFSLNLLKKFKALHPNVPTKSG
IMVGLGETDEEILQVMRDMRAHDIDMLTIGQYLSPSGSHLPVRRYVHPDTFKMFEEEAYK
MGFSHAAVGAMVRSSYHADQQAHAAQQAVTHQE