Protein Info for GFF3672 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Response regulator NasT

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 432 PF08376: NIT" amino acids 41 to 284 (244 residues), 201 bits, see alignment E=4.2e-63 PF03861: ANTAR" amino acids 370 to 421 (52 residues), 70.1 bits, see alignment 1.1e-23

Best Hits

Predicted SEED Role

"Response regulator NasT" in subsystem Nitrate and nitrite ammonification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (432 amino acids)

>GFF3672 Response regulator NasT (Hydrogenophaga sp. GW460-11-11-14-LB1)
LNNHHEMKSGLSFLVAAKRCEIAELQQLALTSALVNVTGRLVHGLQRERGLSNLHLGSQG
ARFADMRARQIEECRQIEAELRTCFDTLDTGSARIGHGARLFSRIAYVLHGLDALEALRE
RVASLAWTPRQATEAYVRLIAGLLAVVFEAADSASDPEVSRLLVALFNFMQGKEFTGQER
AAGSALFASGRADTAEQQRLLHLIESQERCLQVFVEFANPKAVDLWAASQASATLAELER
LRRVLCTAAQGAPLNVQLSQAWFDCCSQRIDRMKAVEDRLALDLLRACEDKITAARADME
AYLALSATAARETDALSFFKLVPASAAPTGSPGFGTPPQAYGLQLERSILELVQEQAHRL
QTMSEELDTVRASLNERKLIERAKGLLMAHRQLSEEEAHKTMRQMAMNQNRRLVEVAEAV
LAMADVLPERPR