Protein Info for PS417_18780 in Pseudomonas simiae WCS417

Annotation: flavin reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 169 PF01613: Flavin_Reduct" amino acids 18 to 163 (146 residues), 152.9 bits, see alignment E=3.8e-49

Best Hits

Swiss-Prot: 44% identical to HSAB_MYCTO: Flavin-dependent monooxygenase, reductase subunit HsaB (hsaB) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: None (inferred from 89% identity to pen:PSEEN2748)

MetaCyc: 44% identical to 3-hydroxy-9,10-seconandrost-1,3,5(10)-triene-9,17-dione 4-hydroxylase reductase component (Mycobacterium tuberculosis H37Rv)
RXN-12446 [EC: 1.5.1.36]

Predicted SEED Role

"Nitrilotriacetate monooxygenase component B (EC 1.14.13.-)" in subsystem Aromatic Amin Catabolism (EC 1.14.13.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.14.13.-

Use Curated BLAST to search for 1.14.13.- or 1.5.1.36

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U9D8 at UniProt or InterPro

Protein Sequence (169 amino acids)

>PS417_18780 flavin reductase (Pseudomonas simiae WCS417)
MSRPRAAIEPLSFREALGHYASGITVITSHIDGEPIGFTCQSFYSVSMNPPLVSFSVMAS
SASYPKIRQAGRFAVNILSGAQVRISNQFARRGTDKWHDVDWQASPLGNPIIAGSLHWLD
CDIHAEHAAGDHLIVIGEVKALNLQEAEATQPLLYFKGQYCNIAAPDVV