Protein Info for GFF3670 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Cyanate ABC transporter, permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 305 transmembrane" amino acids 52 to 72 (21 residues), see Phobius details amino acids 118 to 137 (20 residues), see Phobius details amino acids 149 to 169 (21 residues), see Phobius details amino acids 175 to 196 (22 residues), see Phobius details amino acids 217 to 236 (20 residues), see Phobius details amino acids 241 to 262 (22 residues), see Phobius details amino acids 270 to 295 (26 residues), see Phobius details TIGR01183: nitrate ABC transporter, permease protein" amino acids 95 to 288 (194 residues), 249.9 bits, see alignment E=9.1e-79 PF00528: BPD_transp_1" amino acids 129 to 287 (159 residues), 82.5 bits, see alignment E=1.6e-27

Best Hits

Swiss-Prot: 47% identical to NRTB_PHOLA: Nitrate import permease protein NrtB (nrtB) from Phormidium laminosum

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 77% identity to dac:Daci_2376)

Predicted SEED Role

"Cyanate ABC transporter, permease protein" in subsystem Cyanate hydrolysis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (305 amino acids)

>GFF3670 Cyanate ABC transporter, permease protein (Hydrogenophaga sp. GW460-11-11-14-LB1)
MVSAVFHTPLEAVAPSPAVAVSHPKPVAAQPVAEPRRQAAPSLWRERLAGFFRSVLPPAL
GLGFLVLVWSLVASGNSGIPTPLATWTQAVGVFSDPFYQAGPNDQGVGWNVLMSLQRVAV
GFGLAALVGIPAGFAIGRFDFLSRMFNPLISLLRPVSPLAWLPIGLLVFKGANPAAIWTI
FICSIWPMIINTAVGVQRVPQDYMNVARVLNLSEWKIFTKILFPAVLPYLLTGVRLAVGT
AWLVIVAAEMLTGGVGIGFWVWDEWNNLNVASIIIAIFVIGVVGLVLEFGLIKLATLFTF
EEVKS