Protein Info for GFF3670 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: DNA internalization-related competence protein ComEC/Rec2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 737 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 32 to 52 (21 residues), see Phobius details amino acids 205 to 226 (22 residues), see Phobius details amino acids 238 to 257 (20 residues), see Phobius details amino acids 285 to 304 (20 residues), see Phobius details amino acids 310 to 327 (18 residues), see Phobius details amino acids 341 to 363 (23 residues), see Phobius details amino acids 373 to 394 (22 residues), see Phobius details amino acids 406 to 424 (19 residues), see Phobius details amino acids 436 to 452 (17 residues), see Phobius details amino acids 458 to 474 (17 residues), see Phobius details PF13567: DUF4131" amino acids 9 to 140 (132 residues), 34.6 bits, see alignment E=2.3e-12 TIGR00361: DNA internalization-related competence protein ComEC/Rec2" amino acids 49 to 701 (653 residues), 865 bits, see alignment E=3.1e-264 PF03772: Competence" amino acids 184 to 450 (267 residues), 183.4 bits, see alignment E=8.8e-58 TIGR00360: ComEC/Rec2-related protein" amino acids 204 to 387 (184 residues), 160.7 bits, see alignment E=4e-51 PF00753: Lactamase_B" amino acids 488 to 661 (174 residues), 67.2 bits, see alignment E=3e-22

Best Hits

Swiss-Prot: 70% identical to YCAI_ECOLI: Uncharacterized protein YcaI (ycaI) from Escherichia coli (strain K12)

KEGG orthology group: K02238, competence protein ComEC (inferred from 75% identity to cko:CKO_02157)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (737 amino acids)

>GFF3670 DNA internalization-related competence protein ComEC/Rec2 (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MILPVLPDTWILAVLFCLACLLCLIPHHYARYAALTLLFFMWGIFAARQAIWAGNVLPAA
TQEATVVITATDHMTTHYGRITHLRGKPLFPAVGIVLHGQYLPTEVCAGQQWAMTLKVRA
VHGQLNEGGFDSQRYALAQHQPLTGRFLQAKAINPECSLRGRYLASLRATLAPYPWQQVI
LALGMGERGAVSQEVKAVMRDTGTAHLMAISGLHIAFAALLAAGLIRGGQFFLPVRWIRW
QTPLLGGILCAICYAWLTGLQPPALRTVAALSVWGGLKLSGRQWSGWQVWCCCLAAIIFA
DPVAVISQSLWLSAFAVAGLLFWYQWFPAPNGNFPRGLRWLLNLLHLQAGITLLLLPLQV
ALFHGISVTAMLANLFAVPWVTFVTVPLILAGMILHLTGPFFLEEWVWYLTDRALAALFY
LLNALPQGWVNIDNRWQWLTLLPWLTLIAWRLNVWRTWPAVCLCGLLLMSWPLWRPINAS
GWQVHMLDVGQGLAIAIVRGDKVILYDTGRAWPEGDSGQQVIIPWLRWHNLTPEGVILSH
EHLDHRGGLRSLQQVWPSMWIRSPLGWQGHLPCFRGEQWQWQGLTFQAHWPLRESADRGN
NRSCVVKVDDGVHSILLTGDIEAGAEQKMLSRYWRHLAATFIQVPHHGSNTSSSLPFIQR
VHGEAALASASRYNAWRLPSRKVKQRYRQQAYQWFDTPHQGQISLRFSPQGWRIQGLRDQ
ILPRWYHQWFGVSEDNG