Protein Info for GFF367 in Sphingobium sp. HT1-2

Annotation: Leucyl/phenylalanyl-tRNA--protein transferase (EC 2.3.2.6)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF03588: Leu_Phe_trans" amino acids 7 to 177 (171 residues), 224 bits, see alignment E=4.4e-71 TIGR00667: leucyl/phenylalanyl-tRNA--protein transferase" amino acids 9 to 188 (180 residues), 190.5 bits, see alignment E=1.1e-60

Best Hits

Swiss-Prot: 68% identical to LFTR_SPHWW: Leucyl/phenylalanyl-tRNA--protein transferase (aat) from Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273)

KEGG orthology group: K00684, leucyl/phenylalanyl-tRNA--protein transferase [EC: 2.3.2.6] (inferred from 80% identity to sch:Sphch_1695)

Predicted SEED Role

"Leucyl/phenylalanyl-tRNA--protein transferase (EC 2.3.2.6)" in subsystem Protein degradation (EC 2.3.2.6)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.2.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (250 amino acids)

>GFF367 Leucyl/phenylalanyl-tRNA--protein transferase (EC 2.3.2.6) (Sphingobium sp. HT1-2)
MTIDPLLLLQAYAIGVFPMSDDRQADDVYWVEPKRRAILPLHGLHLSRSLSKTIRQDRFR
VTANRAFAGIVALCAEAAPDRPSTWINGPIERAYRHLHELGFAHSIECWDGDELVGGLYG
VALGGAFFGESMVSRRTDASKVALAWLVARMRFGGFGLLDCQFMTDHLRSMGAQEISQRD
YLQLLGVAVGDVPLGAGDAVLSAGSGAAAELAFAPLAGDAAAGTLPLSPSLTVAGPLSGH
SIVQLLTQTS