Protein Info for GFF3669 in Variovorax sp. SCN45

Annotation: Two-component system response regulator protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 456 PF00072: Response_reg" amino acids 5 to 114 (110 residues), 89.9 bits, see alignment E=5.1e-29 PF00158: Sigma54_activat" amino acids 140 to 306 (167 residues), 231.7 bits, see alignment E=1.7e-72 PF14532: Sigma54_activ_2" amino acids 141 to 311 (171 residues), 85.8 bits, see alignment E=1.3e-27 PF07728: AAA_5" amino acids 163 to 282 (120 residues), 36.8 bits, see alignment E=1.5e-12 PF00004: AAA" amino acids 164 to 297 (134 residues), 29.9 bits, see alignment E=2.8e-10 PF07724: AAA_2" amino acids 164 to 273 (110 residues), 31.9 bits, see alignment E=5.4e-11 PF02954: HTH_8" amino acids 413 to 453 (41 residues), 44.2 bits, see alignment 5e-15

Best Hits

KEGG orthology group: None (inferred from 85% identity to vpe:Varpa_5556)

Predicted SEED Role

"Response regulator of zinc sigma-54-dependent two-component system" in subsystem Zinc resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (456 amino acids)

>GFF3669 Two-component system response regulator protein (Variovorax sp. SCN45)
MAHLLIVDDDDAFRDTLAETLQGLGHETVAVASGAEAVDTASRQRFDAVFLDHRMPGMDG
LQTLAALQARMARLPPVIVLTAFSSAGNTIEAMRLGAFDHLAKPISREAVREVLQRALQQ
HTAASSAATVTQDDDDGTDLIGPSQAMREVHKRIGLAAANSMPVLVLGETGTGKEMVARA
LHRHSARAGRPFVAVNCSAIPKELLESELFGHVRGAFTGATGERPGCFRAADGGVLLLDE
IGDMSLDVQAKILRALQEGEVTPLGSHRTVKVDVRVVAATHRDLAAAVREGRFREDLLYR
LDVLSIRMPPLRERLADIIPLAEHFLRRAAMQGAPDAVPNKALSAEAAQRLLSHPWPGNV
RELRNVMERCHALVRHRVIGGADLDLALGASPAGEASATLPADWLEGELPAAVERLERLL
IAHALAQTQGNRAETARRLGIHRQLLYRKLAQYGLD