Protein Info for GFF3669 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Nitrate ABC transporter, ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 268 PF00005: ABC_tran" amino acids 27 to 169 (143 residues), 109.9 bits, see alignment E=7.9e-36 TIGR01184: nitrate ABC transporter, ATP-binding proteins C and D" amino acids 27 to 257 (231 residues), 340.3 bits, see alignment E=2.8e-106

Best Hits

Swiss-Prot: 64% identical to NASD_KLEOX: Nitrate transport protein NasD (nasD) from Klebsiella oxytoca

KEGG orthology group: K02049, sulfonate/nitrate/taurine transport system ATP-binding protein (inferred from 85% identity to vap:Vapar_3524)

Predicted SEED Role

"Nitrate ABC transporter, ATP-binding protein" in subsystem Nitrate and nitrite ammonification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (268 amino acids)

>GFF3669 Nitrate ABC transporter, ATP-binding protein (Hydrogenophaga sp. GW460-11-11-14-LB1)
MSNASKYIEIQGVEQTFKTRKGNFPALREINLTVAKGEFVTLIGHSGCGKSTLLNLIAGL
TTPTSGVLICADKEIAGPGPERAVVFQNHSLLPWLTCFENVHLAVERVFGGTEGKAQLKA
RTEAALALVGLTAAAQKRPGEISGGMKQRVGIARALSMEPKVLLMDEPFGALDALTRAKL
QDELLEIVARTHSTVVMVTHDVDEAVLLSDRIVMLTNGPAATIGEVLRVDLPRPRQRVAL
ADDPTYQQCRKAVIDFLYTRQAHVEKAA