Protein Info for GFF3668 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Nitrate/nitrite transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 404 transmembrane" amino acids 15 to 37 (23 residues), see Phobius details amino acids 51 to 71 (21 residues), see Phobius details amino acids 81 to 100 (20 residues), see Phobius details amino acids 106 to 126 (21 residues), see Phobius details amino acids 138 to 157 (20 residues), see Phobius details amino acids 169 to 188 (20 residues), see Phobius details amino acids 214 to 237 (24 residues), see Phobius details amino acids 249 to 269 (21 residues), see Phobius details amino acids 277 to 298 (22 residues), see Phobius details amino acids 304 to 324 (21 residues), see Phobius details amino acids 331 to 352 (22 residues), see Phobius details amino acids 364 to 383 (20 residues), see Phobius details PF07690: MFS_1" amino acids 19 to 347 (329 residues), 126.6 bits, see alignment E=5.6e-41

Best Hits

KEGG orthology group: K02575, MFS transporter, NNP family, nitrate/nitrite transporter (inferred from 78% identity to pna:Pnap_1411)

Predicted SEED Role

"Nitrate/nitrite transporter" in subsystem Nitrate and nitrite ammonification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (404 amino acids)

>GFF3668 Nitrate/nitrite transporter (Hydrogenophaga sp. GW460-11-11-14-LB1)
MAGFRAFLKAGHSPTLLASFVYFTYCCGVWVTNGAMAPFIKDALQLSPAQLGVMLSVPIF
AGALMRFPLGVLAQYIGRKNATLVEMGGIAIALLFGYFFVDTFNDLLAMGVLLGIAGASF
GVALSLGSGSFPARYKGLAMGLVGAGNVGTSLSALFAPQLAQAYGWQSVYGMAALGLLLP
VAVMIVFAREPDDVDKHAGLREHAACLFEKDGWAFSAIYAITFGGFIGLTTFLPSYYYDQ
FGVSKVQAGQLTMLAAFMGAALRIFGGWISDHWGGINTLTAVLIVIAGSLLACGLAGGSL
VVTTLLLMLCFAALGAGNGALFQLVPLRWPLTTAVAGSMIGEIGALGGGLVPNAMGLSRQ
YTGTYFWGFALFAVLALCALGMMRFMQIRWTRTWAEKGGRARSA