Protein Info for GFF3663 in Variovorax sp. SCN45

Annotation: Permease of the drug/metabolite transporter (DMT) superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 281 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 30 to 49 (20 residues), see Phobius details amino acids 61 to 82 (22 residues), see Phobius details amino acids 91 to 110 (20 residues), see Phobius details amino acids 117 to 138 (22 residues), see Phobius details amino acids 145 to 165 (21 residues), see Phobius details amino acids 176 to 195 (20 residues), see Phobius details amino acids 207 to 224 (18 residues), see Phobius details amino acids 236 to 254 (19 residues), see Phobius details amino acids 260 to 278 (19 residues), see Phobius details PF00892: EamA" amino acids 6 to 129 (124 residues), 43.9 bits, see alignment E=1.5e-15 amino acids 147 to 276 (130 residues), 52.9 bits, see alignment E=2.5e-18

Best Hits

KEGG orthology group: None (inferred from 84% identity to vpe:Varpa_5562)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (281 amino acids)

>GFF3663 Permease of the drug/metabolite transporter (DMT) superfamily (Variovorax sp. SCN45)
MPSTFHALLAIALWATLASLGTSLSHLPPFLTTGIALIVGSVPSWPLVLRDRGAWKVPPR
TLALGIYGLFGYHFLLFMALRIAPPVEANLVNYLWPLLMVVLAPVLLTGMSLRPVHVVAA
LLGFAGAAAAILGAQGAAASGPATSYWGFLPALASAVIWASYSLWTKRVPAFPTSAIGLF
GLVSGLLALACHAVLETPAALSGRDWLLLVLCGLGPLGAAFFLWDMALKRGDARQIGILS
YITPLASTALLLAVTGRPLTWSIALAAILIISAALMGTRAR