Protein Info for GFF3656 in Pseudomonas sp. DMC3

Annotation: Anaerobic nitric oxide reductase transcription regulator NorR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 471 PF13188: PAS_8" amino acids 24 to 70 (47 residues), 25 bits, see alignment 5.9e-09 PF08448: PAS_4" amino acids 26 to 117 (92 residues), 27.7 bits, see alignment E=1.2e-09 PF14532: Sigma54_activ_2" amino acids 159 to 330 (172 residues), 79.3 bits, see alignment E=1.6e-25 PF00158: Sigma54_activat" amino acids 159 to 326 (168 residues), 225 bits, see alignment E=2.1e-70 PF01078: Mg_chelatase" amino acids 173 to 271 (99 residues), 20.7 bits, see alignment E=1.1e-07 PF07728: AAA_5" amino acids 181 to 299 (119 residues), 29.7 bits, see alignment E=2.6e-10 PF02954: HTH_8" amino acids 425 to 464 (40 residues), 40.6 bits, see alignment 7.5e-14

Best Hits

KEGG orthology group: None (inferred from 94% identity to pfo:Pfl01_3077)

Predicted SEED Role

"Sigma-54 dependent transcriptional regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (471 amino acids)

>GFF3656 Anaerobic nitric oxide reductase transcription regulator NorR (Pseudomonas sp. DMC3)
MNTTESLKDYQRVRTLAIRSLFEIIEQSSEGTVIVDRDANIVWMNERYARRFGLDSAAGA
IGKPCESVIPGSLLREVVRTGRPILLDMQDTPKEPLVVMRLPIHDDAGSVIGAIGFALFD
ELRTLSPMLKRYLSMQEELASTRSLLRARQTKYNFAHFIGTSAASLEVKRRARRSASADS
PVLLLGETGTGKELLAQAIHSASPRAHKAFVSINSAAIPEALLEAEFFGTAPGAFTGADR
KGRTGKLQIAQGGTLFLDEIGDMPLPLQSKLLRVLQEKEFEPVGSNEVIQSDVRVIAATS
TDLQAAIKRGEFRADLYYRLNVLPIQVPPLRERLDDLPALSEAILEELRSQHELHRDALA
LLGQHAWPGNIRELRNVLERAALLSDDLMLTEQDIRGAIGTFTPVERTAEPSMQASAGET
FAQARARFDRQLIESTLAQCAGKVPEAAVRLGLGRSTLYKKMAALGIAEST