Protein Info for GFF3654 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: FIG138315: Putative alpha helix protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 215 PF04751: DUF615" amino acids 36 to 196 (161 residues), 161.1 bits, see alignment E=9.3e-52

Best Hits

Swiss-Prot: 41% identical to Y910_CUPNJ: UPF0307 protein Reut_A0910 (Reut_A0910) from Cupriavidus necator (strain JMP 134 / LMG 1197)

KEGG orthology group: K09889, ribosome-associated protein (inferred from 66% identity to rfr:Rfer_2888)

Predicted SEED Role

"FIG138315: Putative alpha helix protein" in subsystem Putative TldE-TldD proteolytic complex

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (215 amino acids)

>GFF3654 FIG138315: Putative alpha helix protein (Hydrogenophaga sp. GW460-11-11-14-LB1)
MSRKPTKGYFVRGQFVALGSELDLELKRELKGDAEMSKTDLKRESDRLQALGENLLTLRA
DLTQKLGLSEKLLDAVAEARRITNFEGRRRQMQFIGKLMRALDEDTIAAVEAALDEQSKG
SAKETLSLHLAEQWRDRLIGDDDALTQWLQQDAGADVQHLRALIRQARKDAQATQERPGE
AVRHGKAYREIFQIVKATLNQGEDDDGAPTDEDQP