Protein Info for GFF3649 in Variovorax sp. SCN45

Annotation: C-type cytochrome biogenesis protein ResA (thioredoxin)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF08534: Redoxin
  • amino acids 28 to 153 (126 residues), 93.3 bits, E=2e-30
• PF00578: AhpC-TSA
  • amino acids 29 to 143 (115 residues), 69.6 bits, E=3.7e-23
• PF13905: Thioredoxin_8
  • amino acids 49 to 141 (93 residues), 28.2 bits, E=2.9e-10

Best Hits

KEGG orthology group: None (inferred from 95% identity to vpe:Varpa_5578)

MetaCyc: 54% identical to protein disulfide reductase CcsX (Bordetella pertussis)
RXN-21403 [EC: 1.8.4.16]

Predicted SEED Role

"Cytochrome c-type biogenesis protein CcmG/DsbE, thiol:disulfide oxidoreductase" in subsystem Biogenesis of c-type cytochromes or Periplasmic disulfide interchange

MetaCyc Pathways

• periplasmic disulfide bond reduction (1/2 steps found)
• cytochrome c biogenesis (system II type) (1/3 steps found)
• cytochrome c biogenesis (system I type) (1/11 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.4.16

Protein Sequence (165 amino acids)

>GFF3649 C-type cytochrome biogenesis protein ResA (thioredoxin) (Variovorax sp. SCN45)
MKKYIAAAAVVIALATGVGVYLGSGATAAPASTFVLLDGTQKSTADLKGKVTLVNFWATS
CVTCVGEMPKVIATYDKYKAQGYDTLAVAMSYDPPSYVVNFAETRKLPFKVAIDNTGSVA
QAWGDVKLTPTTYLVNKRGEIVKRYVGEPDFAELHKLIEKLLAEA