Protein Info for PS417_01855 in Pseudomonas simiae WCS417

Annotation: phosphoribosyl-AMP cyclohydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01502: PRA-CH
  • amino acids 30 to 104 (75 residues), 116 bits, E=2.7e-38

Best Hits

Swiss-Prot: 92% identical to HIS31_PSEF5: Phosphoribosyl-AMP cyclohydrolase 1 (hisI1) from Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)

KEGG orthology group: K01496, phosphoribosyl-AMP cyclohydrolase [EC: 3.5.4.19] (inferred from 97% identity to pfs:PFLU0386)

Predicted SEED Role

"Phosphoribosyl-AMP cyclohydrolase (EC 3.5.4.19)" in subsystem Histidine Biosynthesis (EC 3.5.4.19)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (44/46 steps found)
• L-histidine biosynthesis (10/10 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of plant hormones
• Histidine metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.5.4.19

Use Curated BLAST to search for 3.5.4.19

Sequence Analysis Tools

See U1SXT7 at UniProt or InterPro

Protein Sequence (130 amino acids)

>PS417_01855 phosphoribosyl-AMP cyclohydrolase (Pseudomonas simiae WCS417)
MKDWLDEIKWDSDGLVPAIAQDYKTGRVLMMAWMNREALSLTAAEQRAIYWSRSRGKLWR
KGEESGHVQTLHEMRIDCDADVVILMVEQIGDIACHTGRHSCFYRVFENGEWKTVEPVLK
DPDAIYSAGH