Protein Info for GFF3636 in Sphingobium sp. HT1-2

Annotation: ABC transporter, substrate-binding protein (cluster 10, nitrate/sulfonate/bicarbonate)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 324 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF13379: NMT1_2" amino acids 54 to 195 (142 residues), 24.8 bits, see alignment E=2.8e-09 PF09084: NMT1" amino acids 55 to 249 (195 residues), 46.9 bits, see alignment E=4.9e-16 PF12974: Phosphonate-bd" amino acids 69 to 235 (167 residues), 27.9 bits, see alignment E=2.2e-10

Best Hits

KEGG orthology group: K02051, sulfonate/nitrate/taurine transport system substrate-binding protein (inferred from 80% identity to sjp:SJA_C2-04370)

Predicted SEED Role

"ABC-type nitrate/sulfonate/bicarbonate transport systems, periplasmic components" in subsystem Alkanesulfonate assimilation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (324 amino acids)

>GFF3636 ABC transporter, substrate-binding protein (cluster 10, nitrate/sulfonate/bicarbonate) (Sphingobium sp. HT1-2)
MLSRRNLLGAAAGSLLLTACGTAGKSRPKLRVSITGKGDGDTRLLFKAAGIQPTGFDLVY
SEFQSGHLVVEALNGGSLDYGGMSEIPPIFAAASTIQSFRQIAVAHGDVNNQVVLVPKGS
KARSIADLKGKRVGYVRATTAQYFLIRMLEEVGLNWDDIIPVAMGVSDGAAAFSQGALDA
WAIYGFPIQRAIATEGARILRTANGILSGNYLVSAHVDALADPDKAAIIREYLALVQKGF
GWAAAHQDEWAGIVAQDIGVPRDYVLDQFRRKSATYELRPVTPEAIGSQQQVADVFFKAG
LVPKRVDVRPLWDARFNDAIPKRG