Protein Info for GFF3636 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: 'Pyridoxamine 5'-phosphate oxidase (EC 1.4.3.5)' transl_table=11

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 218 TIGR00558: pyridoxamine 5'-phosphate oxidase" amino acids 3 to 218 (216 residues), 333.7 bits, see alignment E=2.3e-104 PF01243: PNPOx_N" amino acids 41 to 165 (125 residues), 103.6 bits, see alignment E=9e-34 PF10590: PNP_phzG_C" amino acids 178 to 218 (41 residues), 71.5 bits, see alignment 4.2e-24

Best Hits

Swiss-Prot: 100% identical to PDXH_SALNS: Pyridoxine/pyridoxamine 5'-phosphate oxidase (pdxH) from Salmonella newport (strain SL254)

KEGG orthology group: K00275, pyridoxamine 5'-phosphate oxidase [EC: 1.4.3.5] (inferred from 100% identity to sty:STY1674)

MetaCyc: 91% identical to pyridoxine/pyridoxamine 5'-phosphate oxidase (Escherichia coli K-12 substr. MG1655)
Pyridoxal 5'-phosphate synthase. [EC: 1.4.3.5]; 1.4.3.5 [EC: 1.4.3.5]

Predicted SEED Role

"Pyridoxamine 5'-phosphate oxidase (EC 1.4.3.5)" in subsystem Pyridoxin (Vitamin B6) Biosynthesis (EC 1.4.3.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.4.3.5

Use Curated BLAST to search for 1.4.3.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (218 amino acids)

>GFF3636 'Pyridoxamine 5'-phosphate oxidase (EC 1.4.3.5)' transl_table=11 (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MSDNDQLQQIAHLRREYTKGGLRRRDLPAEPLTLFERWLGQACDARLADPTAMVVATVDD
KGQPYQRIVLLKHYDEKGLVFYTNLGSRKAHQIEHNPRISLLFPWHMLERQVMVTGKAER
LSTLEVVRYFHSRPRDSQIGAWVSKQSSRISARGILESKFLELKQKFQQGEVPLPSFWGG
FRVSIEQMEFWQGGEHRLHDRFLYQRDDGAWKIDRLAP