Protein Info for GFF3635 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Nitrogen regulation protein NR(I)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 476 PF00072: Response_reg" amino acids 5 to 110 (106 residues), 72.8 bits, see alignment E=9.2e-24 PF00158: Sigma54_activat" amino acids 142 to 307 (166 residues), 232.8 bits, see alignment E=6.4e-73 PF14532: Sigma54_activ_2" amino acids 143 to 312 (170 residues), 52.6 bits, see alignment E=2.2e-17 PF07728: AAA_5" amino acids 165 to 287 (123 residues), 37.8 bits, see alignment E=6.5e-13 PF25601: AAA_lid_14" amino acids 313 to 384 (72 residues), 81.7 bits, see alignment E=9.9e-27 PF02954: HTH_8" amino acids 425 to 465 (41 residues), 32.7 bits, see alignment 1.7e-11

Best Hits

KEGG orthology group: None (inferred from 62% identity to aav:Aave_1901)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (476 amino acids)

>GFF3635 Nitrogen regulation protein NR(I) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MTHALIVDDDVDASAMLGELIAMQGLTVATANTLRDARKQLALQPPDLVLLDLRLPDGSG
MDLFADPELLANSEVVLLTGHASLETSILALRLGAVDYIVKPITPKQLQGVLSRVSKPSV
FKAEVAGLTASVASTGHFGQLWGRSPSMLQVYEQITRVAGTGVSVFITGESGTGKEVVAQ
TIHELSRRRKMPFIGVNCGAISPNLIESELFGHEKGSFTGADRQHQGFFERAAGGTLFLD
EITEMPLDLQVKLLRVLETGRFLRVGATQSQETDVRIIAATNRQPMQAVADGRLRTDLMY
RLNVFPIDLPPLRERLDDVPLLANRFLRLIGEQEGKEKRFSPEALERLAAYAWPGNVREL
RNAVQRAYVMTAGQTIAAQWLPGAADPPGAPATVAAPVAPVETALAAPDARHPEGSVVLP
LGISLAQAEQTLILATLQHYGRQKERTAAALGISLKTLYNRLKQYAADDKLDGPRP