Protein Info for PS417_18590 in Pseudomonas simiae WCS417

Annotation: SAM-dependent methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 254 PF05175: MTS" amino acids 35 to 168 (134 residues), 23.8 bits, see alignment E=1.3e-08 PF03141: Methyltransf_29" amino acids 37 to 142 (106 residues), 28.7 bits, see alignment E=2.5e-10 PF01209: Ubie_methyltran" amino acids 41 to 157 (117 residues), 67 bits, see alignment E=7.4e-22 PF13489: Methyltransf_23" amino acids 42 to 192 (151 residues), 63.5 bits, see alignment E=9.2e-21 PF03848: TehB" amino acids 46 to 117 (72 residues), 21.4 bits, see alignment E=6.6e-08 PF13847: Methyltransf_31" amino acids 47 to 148 (102 residues), 67.5 bits, see alignment E=5.1e-22 PF13649: Methyltransf_25" amino acids 49 to 141 (93 residues), 86.5 bits, see alignment E=7.5e-28 PF08241: Methyltransf_11" amino acids 49 to 145 (97 residues), 94.8 bits, see alignment E=1.9e-30 PF08242: Methyltransf_12" amino acids 49 to 142 (94 residues), 62.5 bits, see alignment E=2.5e-20

Best Hits

KEGG orthology group: None (inferred from 92% identity to pfs:PFLU4194)

Predicted SEED Role

"SAM-dependent methyltransferase YafE (UbiE paralog)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UCC1 at UniProt or InterPro

Protein Sequence (254 amino acids)

>PS417_18590 SAM-dependent methyltransferase (Pseudomonas simiae WCS417)
MTTTAHTHVVQKQFGEQASAYLSSAVHAQGTEFALLQAELAGQGTARLLDLGCGAGHVSF
HVAPLVKDVVAYDLSQQMLDVVAAAAKDRGLGNITTVHGAAERLPFADGEFDFVFSRYSA
HHWSDLGLALREVRRVLKPGGVAAFVDVLSPGSPLLDTYLQTVEVLRDTSHVRDYSAAEW
MQQLSESGLHVRTSSRQRLRLEYTSWVERMRTPEVLRAAILELQKAMGQEVRDYYEIQAD
GTFSTDVLVVFAER