Protein Info for GFF3632 in Pseudomonas sp. DMC3

Annotation: Sensor protein CzcS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 462 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 170 to 189 (20 residues), see Phobius details TIGR01386: heavy metal sensor kinase" amino acids 8 to 462 (455 residues), 463.9 bits, see alignment E=3.1e-143 PF00672: HAMP" amino acids 187 to 239 (53 residues), 39 bits, see alignment 1.3e-13 PF00512: HisKA" amino acids 245 to 309 (65 residues), 53.6 bits, see alignment E=2.8e-18 PF02518: HATPase_c" amino acids 354 to 462 (109 residues), 70.5 bits, see alignment E=2.4e-23

Best Hits

KEGG orthology group: K07644, two-component system, OmpR family, heavy metal sensor histidine kinase CusS [EC: 2.7.13.3] (inferred from 72% identity to psp:PSPPH_3295)

Predicted SEED Role

No annotation

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (462 amino acids)

>GFF3632 Sensor protein CzcS (Pseudomonas sp. DMC3)
MRSRRQPSLTLRSTVAFAMVAMLAVAGAGFYLYQTMKASVLVYSDHSVMGRLEHFRKLLH
YELAIEKLRDSPQIFKNMLDSEDDIFIIEEPGQPPVIQVNPLNVTLPELPVIGQDTKLSV
SDLRSGVTDSGTRLRAASVVTTSGGRVVRLTAAHLMGKEMAMLAAYRERIYLAVALAFLA
TALLGYLLLRRGLRPLRKMAAHAAAITPERLHSRMDSADTPVELQQLSDAYNAMLDRLAQ
GYQRLTQFSADLAHEIRTPVGSLMGHCQVALRQRRSEDEYQALIASNLEELERISRIVES
ILFLARADEAQAVVERQQLSLHDESQRIAEYFEGLAEERRMSFQITGDGIVLADPLLLRR
ALSNLVANAVRYAYEGTEILIRVLETHGGARIEVENQGPVLGDETLGKLFDRFYRGDASR
HQNSDSYGLGLAIVVAIMQLHDGHVGVEQPRAGTIRFSLSFP