Protein Info for GFF3630 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Putative membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 286 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details PF00529: CusB_dom_1" amino acids 17 to 283 (267 residues), 28.7 bits, see alignment E=2.5e-10 TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 41 to 228 (188 residues), 128.9 bits, see alignment E=1e-41 PF13533: Biotin_lipoyl_2" amino acids 43 to 92 (50 residues), 59.6 bits, see alignment 5.1e-20 PF16576: HlyD_D23" amino acids 44 to 228 (185 residues), 56.9 bits, see alignment E=4.7e-19 PF13437: HlyD_3" amino acids 154 to 233 (80 residues), 36.4 bits, see alignment E=1.9e-12

Best Hits

Swiss-Prot: 84% identical to YDHJ_ECOLI: Uncharacterized protein YdhJ (ydhJ) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 99% identity to seg:SG1676)

Predicted SEED Role

"Putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (286 amino acids)

>GFF3630 Putative membrane protein (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MSLKTIKYFSTLIVAVVAVLAAWWLWNYYMQSPWTRDGKIRAEQVSVTPQVSGSITQLNI
KDNQFVNAGDVLFVIDKTPFHIAELNAQAQLAKAQSDLAKANNEADRRRHLSRNYISAED
LDSANLNVKAMQANVDVALATLKQAQWQLSQTEVKAPVSGWVTNLSTRTGDYASTGKPLF
ALVDSHSFYVMGYFEETKLRHIREGEPALITLYSGNVKLQGHVGSIGRAIYDQSVESDSG
LVPDIKPNVPWVRLAQRVPVRIEFDALPQDITLVSGTTCSVAIGQR