Protein Info for GFF3624 in Variovorax sp. SCN45

Annotation: Putative transmembrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 385 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 53 to 78 (26 residues), see Phobius details amino acids 89 to 109 (21 residues), see Phobius details amino acids 122 to 142 (21 residues), see Phobius details amino acids 162 to 183 (22 residues), see Phobius details amino acids 217 to 241 (25 residues), see Phobius details amino acids 248 to 270 (23 residues), see Phobius details amino acids 276 to 299 (24 residues), see Phobius details amino acids 305 to 323 (19 residues), see Phobius details amino acids 347 to 367 (21 residues), see Phobius details PF04892: VanZ" amino acids 27 to 135 (109 residues), 47.7 bits, see alignment E=1.2e-16

Best Hits

KEGG orthology group: None (inferred from 90% identity to vpe:Varpa_5603)

Predicted SEED Role

"Probable transmembrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (385 amino acids)

>GFF3624 Putative transmembrane protein (Variovorax sp. SCN45)
MVATVEKPHKSAAFPLALAYAALIVYASLYPFADWRDQGIVPWAYLWAPWPKYWTGFDFA
INVVGYVPFGFLCALAVLRTRRSASAWRVVLRATVAGAAIAFSMETLQSYLPVRIPSNVD
LALNTTGTIIGAVLAAGLERLGAIAHWSRARSQWFVEESRGALVLLALWPFALLFPAAVT
FGLGQVFERLEVAISEWLLDTPFIDWLPLRQFELEPLVPAVELLCVMLGALVPCLLGYLV
ARSVVQRAIMLPLILLVGVAASALSAALSYGPAHAWAWLDLPVQVGMAAALFAGILLLLA
PRRLCAALLLMGLVLQLSLLNQAPESAYFAQTLATWEQGRFIRFHGLAQWLGWVWPFAVL
AYVVAALSRRGRGSGDGGPAAGGGH