Protein Info for GFF3616 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Putative transport protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 401 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details transmembrane" amino acids 40 to 61 (22 residues), see Phobius details amino acids 73 to 91 (19 residues), see Phobius details amino acids 98 to 119 (22 residues), see Phobius details amino acids 131 to 153 (23 residues), see Phobius details amino acids 159 to 178 (20 residues), see Phobius details amino acids 209 to 230 (22 residues), see Phobius details amino acids 237 to 258 (22 residues), see Phobius details amino acids 270 to 288 (19 residues), see Phobius details amino acids 299 to 321 (23 residues), see Phobius details amino acids 334 to 355 (22 residues), see Phobius details amino acids 360 to 377 (18 residues), see Phobius details TIGR00710: drug resistance transporter, Bcr/CflA subfamily" amino acids 4 to 379 (376 residues), 443.5 bits, see alignment E=4.4e-137 PF07690: MFS_1" amino acids 13 to 342 (330 residues), 149 bits, see alignment E=1.8e-47 PF00083: Sugar_tr" amino acids 39 to 119 (81 residues), 36.9 bits, see alignment E=2.1e-13

Best Hits

Swiss-Prot: 85% identical to YDHC_ECOLI: Inner membrane transport protein YdhC (ydhC) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to seg:SG1690)

MetaCyc: 85% identical to purine nucleoside transporter PunC (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-631

Predicted SEED Role

"Putative transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (401 amino acids)

>GFF3616 Putative transport protein (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MQPGKGFLVWLAGLSVLGFLATDMYLPAFAAIQADLQTPAAAVSASLSLFLAGFAVAQLL
WGPLSDRYGRKPILLLGLSIFALGSLGMLWVESAAALLTLRFVQAVGVCAATVIWQALVT
DYYPSQKINRIFATIMPLVGLSPALAPLLGSWILTHFSWQAIFATLFVITLLLMLPALRL
KPSGKARTEGQDKLTFATLLRSKTYRGNVLIYAACSASFFAWLTGSPFILSAMGYSPAVI
GLSYVPQTIAFLIGGYGCRAALQKWQGYQLLPWLLGLYALSVIATWGAGLLNNASLVEIL
IPFCVMAIANGAIYPIVVAQALRPFPQATGRAAALQNTLQLGLCFLASLVVSWLISTPLL
TTTSVMLSTVVLAALGYKMQSHADCAETGFPHANVAHDKSH