Protein Info for GFF3615 in Xanthobacter sp. DMC5

Annotation: DNA replication and repair protein RecF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 602 PF13476: AAA_23" amino acids 20 to 68 (49 residues), 28.7 bits, see alignment 3e-10 PF13304: AAA_21" amino acids 269 to 335 (67 residues), 39.5 bits, see alignment E=1.1e-13

Best Hits

KEGG orthology group: None (inferred from 93% identity to bra:BRADO1247)

Predicted SEED Role

"conserved hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (602 amino acids)

>GFF3615 DNA replication and repair protein RecF (Xanthobacter sp. DMC5)
MDAKTNTSTLVDVAGASILRLKIERYRAFQKFDWFPKTGLNVILGGGDAGKTTILEAIAL
LLNPSNASLVSDNDYWRRQRKAGFFIGAVISLPPDSSIVTQSRPAFPWEWDGRQACKPQE
SDEGEPARPVGPPVYKISVSGSEELDLTYAIHNPNDTTDIFSPMLRREIGLVRLGGDDRN
DRDLRLVQGSALDRLLSDKALRSRLTSTFSDVDVKAELQTEGQEAMRQLNETFGERALPH
DLGLGLSAGQGQSISALIGLTAAIEESRLPLSSWGSGTRRLASLAVAQACRSGCPITLVD
EAERGLEPYRQRKLVSELAAGPSQVVMTTHSAPALAAAEPATIWYLSQGHVIAELASPRS
VQLQKRDPEAFLSRLTLVGEGPTEVGFVTEVLQREIATDLLDLGVRLCDGQGNTFTLELL
EEFTKAKLGLAAFVDCEGDNTTRWNNLKSAMGDLLFQWPSGCTEANVIAHICDDKLEALL
IDPDDIHTQPRLATLVERLKVLEPTAEFTKHDFATVKAVAGERLRALIIAAASGDSEGAA
EKEAKTWKKHGKRWFKSLDGGRELADKAYVLGAMVKVKPQLQPLIDALTALAARTPKASE
NG