Protein Info for PS417_18505 in Pseudomonas simiae WCS417

Annotation: gamma-glutamylputrescine oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 427 PF01494: FAD_binding_3" amino acids 29 to 62 (34 residues), 25.5 bits, see alignment 1.9e-09 PF01266: DAO" amino acids 31 to 381 (351 residues), 238 bits, see alignment E=5.9e-74 PF13450: NAD_binding_8" amino acids 34 to 63 (30 residues), 22.6 bits, see alignment (E = 2.7e-08)

Best Hits

Swiss-Prot: 67% identical to PUUB_ECOLI: Gamma-glutamylputrescine oxidoreductase (puuB) from Escherichia coli (strain K12)

KEGG orthology group: K09471, gamma-glutamylputrescine oxidase [EC: 1.4.3.-] (inferred from 99% identity to pfs:PFLU4179)

MetaCyc: 67% identical to gamma-glutamylputrescine oxidase (Escherichia coli K-12 substr. MG1655)
1.4.3.M3 [EC: 1.4.3.M3]

Predicted SEED Role

"Nucleoside-diphosphate-sugar epimerases"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.4.3.-

Use Curated BLAST to search for 1.4.3.- or 1.4.3.M3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7TZA5 at UniProt or InterPro

Protein Sequence (427 amino acids)

>PS417_18505 gamma-glutamylputrescine oxidoreductase (Pseudomonas simiae WCS417)
MANTPYPQSYYAASANAVPPRPVLQGEVETDVCVIGAGYTGLSSALFLLENGFRVTVLEA
AKVGFGASGRNGGQIVNSYSRDIDVIERSVGPKQAQLLGQMAFEGGKIIRERVAKYQIQC
DLKDGGVFAALNSKHMGHLESQKRLWERYGHTQLELLDERRIREVVACDNYVGGLLDMSG
GHIHPLNLALGEAAAVESLGGTIYEQSAAVRIERGANPVVHTAQGKVRAKFIIVAGNAYL
GNLVPELAAKSMPCGTQVITTAPLGDELAKTLLPQDYCVEDCNYLLDYYRLTSDKRLIFG
GGVVYGARDPANIEAIIRPKMLKAFPQLKDVKIDYAWTGNFLLTLSRLPQVGRLGDNIYY
SQGCSGHGVTYTHLAGKVLAEALRGQAERFDAFADLPHYPFPGGQLLRTPFAAMGAWYYG
LRDKLGF