Protein Info for GFF3613 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Multi antimicrobial extrusion protein (Na(+)/drug antiporter), MATE family of MDR efflux pumps

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 457 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details transmembrane" amino acids 53 to 72 (20 residues), see Phobius details amino acids 92 to 113 (22 residues), see Phobius details amino acids 129 to 147 (19 residues), see Phobius details amino acids 160 to 183 (24 residues), see Phobius details amino acids 189 to 212 (24 residues), see Phobius details amino acids 242 to 264 (23 residues), see Phobius details amino acids 276 to 301 (26 residues), see Phobius details amino acids 315 to 336 (22 residues), see Phobius details amino acids 350 to 367 (18 residues), see Phobius details amino acids 387 to 407 (21 residues), see Phobius details amino acids 419 to 438 (20 residues), see Phobius details TIGR00797: MATE efflux family protein" amino acids 17 to 422 (406 residues), 409.9 bits, see alignment E=5.2e-127 PF01554: MatE" amino acids 17 to 177 (161 residues), 134.7 bits, see alignment E=1.2e-43 amino acids 244 to 405 (162 residues), 122.7 bits, see alignment E=6.1e-40

Best Hits

Swiss-Prot: 100% identical to MDTK_SALTI: Multidrug resistance protein MdtK (mdtK) from Salmonella typhi

KEGG orthology group: K03327, multidrug resistance protein, MATE family (inferred from 100% identity to see:SNSL254_A1535)

MetaCyc: 93% identical to multidrug efflux pump MdtK (Escherichia coli K-12 substr. MG1655)
RXN0-2561; TRANS-RXN-347; TRANS-RXN-348; TRANS-RXN-349

Predicted SEED Role

"Multi antimicrobial extrusion protein (Na(+)/drug antiporter), MATE family of MDR efflux pumps" in subsystem Multidrug Resistance Efflux Pumps

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (457 amino acids)

>GFF3613 Multi antimicrobial extrusion protein (Na(+)/drug antiporter), MATE family of MDR efflux pumps (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
VQKYTSEARQLLALAIPVILAQVAQTAMGFVDTVMAGGYSATDMAAVAIGTSIWLPAILF
GHGLLLALTPVIAQLNGSGRRERIAHQVRQGFWLAGFVSVLVMIVLWNAGYIIRSMHNID
PALADKAVGYLRALLWGAPGYLFFQVARNQCEGLAKTKPGMVMGFLGLLVNIPVNYIFIY
GHFGMPELGGIGCGVATAAVYWVMFIAMLSYIKHARSMRDIRNEKGFGKPDSVVMKRLIQ
LGLPIALALFFEVTLFAVVALLVSPLGIVDVAGHQIALNFSSLMFVLPMSLAAAVTIRVG
YRLGQGSTLDAQTAARTGLGVGICMAVVTAIFTVTLRKHIALLYNDNPEVVALAAQLMLL
AAVYQISDSIQVIGSGILRGYKDTRSIFFITFTAYWVLGLPSGYILALTDLVVDRMGPAG
FWMGFIIGLTSAAVLMMLRMRYLQRQPSAIILQRAAR